Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EI31

Protein Details
Accession I3EI31   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
21-43VGATEKKKKKTNHMSKSQYNFRSHydrophilic
NLS Segment(s)
PositionSequence
8-30KKIIPAGKAPAKGVGATEKKKKK
Subcellular Location(s) cyto_mito 9.666, mito 9.5, cyto 9.5, cyto_nucl 8.333, mito_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MEAKTGDKKIIPAGKAPAKGVGATEKKKKKTNHMSKSQYNFRSSIKRMLKNTYQAAPPQVSGPVVESLCNIVCDIIDKLSNDCEILARKVGKQTINLEEVMAAVMVNLSGELRTHAIKEIKEAVAKVPSRSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.44
4 0.4
5 0.34
6 0.33
7 0.3
8 0.3
9 0.31
10 0.36
11 0.45
12 0.49
13 0.55
14 0.62
15 0.66
16 0.68
17 0.72
18 0.77
19 0.77
20 0.79
21 0.82
22 0.83
23 0.85
24 0.84
25 0.77
26 0.68
27 0.6
28 0.54
29 0.53
30 0.48
31 0.49
32 0.48
33 0.5
34 0.5
35 0.54
36 0.55
37 0.53
38 0.54
39 0.47
40 0.41
41 0.35
42 0.35
43 0.29
44 0.25
45 0.19
46 0.16
47 0.13
48 0.11
49 0.11
50 0.1
51 0.09
52 0.09
53 0.08
54 0.09
55 0.09
56 0.09
57 0.07
58 0.05
59 0.05
60 0.06
61 0.06
62 0.06
63 0.07
64 0.08
65 0.09
66 0.1
67 0.1
68 0.09
69 0.08
70 0.09
71 0.1
72 0.11
73 0.14
74 0.14
75 0.15
76 0.19
77 0.23
78 0.23
79 0.25
80 0.29
81 0.3
82 0.31
83 0.29
84 0.26
85 0.21
86 0.19
87 0.16
88 0.11
89 0.06
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.04
98 0.05
99 0.07
100 0.08
101 0.1
102 0.15
103 0.2
104 0.2
105 0.24
106 0.29
107 0.3
108 0.31
109 0.31
110 0.29
111 0.33
112 0.35
113 0.33