Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175W9Q9

Protein Details
Accession A0A175W9Q9    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
229-250CIPPRSSSSPPCRTRRTRRGRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 12, cyto 8.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005814  Aminotrans_3  
IPR015424  PyrdxlP-dep_Trfase  
IPR015421  PyrdxlP-dep_Trfase_major  
IPR015422  PyrdxlP-dep_Trfase_small  
Gene Ontology GO:0030170  F:pyridoxal phosphate binding  
GO:0008483  F:transaminase activity  
Pfam View protein in Pfam  
PF00202  Aminotran_3  
Amino Acid Sequences MLNNSAHDLDPSSRQRSAQSALAAAESRFIANNPLSKRQHELAVDALPGGNTRTLLHTSPFPLSMDRGEGAYVWDEDGHKYVDFVGELSAGLYGHSHPVIRQALLSTLDSTGLSLGATTAHEHRYASLLCARFRLARVRMTNSGTEANLHALAGARRFTSRRRVVVFSGAYHGAVLSFPDGRAAANVVDSADFVVAPRYNDVPSALRTITDAEDLAAVLVEPMQGAGGCIPPRSSSSPPCRTRRTRRGRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.39
4 0.4
5 0.37
6 0.32
7 0.29
8 0.28
9 0.29
10 0.27
11 0.22
12 0.19
13 0.14
14 0.13
15 0.12
16 0.11
17 0.14
18 0.15
19 0.22
20 0.25
21 0.34
22 0.36
23 0.38
24 0.44
25 0.42
26 0.45
27 0.4
28 0.37
29 0.31
30 0.3
31 0.27
32 0.22
33 0.19
34 0.13
35 0.13
36 0.11
37 0.09
38 0.07
39 0.08
40 0.11
41 0.13
42 0.15
43 0.16
44 0.17
45 0.19
46 0.2
47 0.21
48 0.19
49 0.17
50 0.17
51 0.17
52 0.16
53 0.14
54 0.13
55 0.12
56 0.11
57 0.11
58 0.11
59 0.1
60 0.07
61 0.08
62 0.08
63 0.09
64 0.1
65 0.11
66 0.09
67 0.09
68 0.09
69 0.09
70 0.08
71 0.08
72 0.07
73 0.05
74 0.05
75 0.05
76 0.05
77 0.04
78 0.04
79 0.05
80 0.04
81 0.05
82 0.06
83 0.06
84 0.06
85 0.12
86 0.13
87 0.13
88 0.13
89 0.12
90 0.13
91 0.15
92 0.15
93 0.1
94 0.09
95 0.09
96 0.09
97 0.08
98 0.07
99 0.05
100 0.04
101 0.03
102 0.03
103 0.03
104 0.04
105 0.05
106 0.06
107 0.07
108 0.08
109 0.08
110 0.08
111 0.1
112 0.1
113 0.11
114 0.14
115 0.15
116 0.15
117 0.16
118 0.17
119 0.16
120 0.17
121 0.23
122 0.21
123 0.25
124 0.28
125 0.32
126 0.34
127 0.35
128 0.34
129 0.29
130 0.28
131 0.22
132 0.19
133 0.15
134 0.13
135 0.11
136 0.1
137 0.08
138 0.08
139 0.08
140 0.09
141 0.09
142 0.08
143 0.1
144 0.12
145 0.15
146 0.24
147 0.3
148 0.34
149 0.38
150 0.41
151 0.41
152 0.47
153 0.45
154 0.35
155 0.32
156 0.27
157 0.23
158 0.19
159 0.17
160 0.1
161 0.08
162 0.07
163 0.06
164 0.06
165 0.06
166 0.07
167 0.07
168 0.07
169 0.07
170 0.08
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.07
177 0.07
178 0.05
179 0.05
180 0.05
181 0.08
182 0.09
183 0.1
184 0.12
185 0.13
186 0.13
187 0.14
188 0.17
189 0.16
190 0.17
191 0.2
192 0.18
193 0.17
194 0.17
195 0.19
196 0.18
197 0.16
198 0.14
199 0.1
200 0.1
201 0.1
202 0.09
203 0.07
204 0.05
205 0.04
206 0.04
207 0.04
208 0.03
209 0.03
210 0.04
211 0.04
212 0.04
213 0.05
214 0.09
215 0.1
216 0.12
217 0.13
218 0.14
219 0.19
220 0.24
221 0.29
222 0.35
223 0.44
224 0.54
225 0.62
226 0.69
227 0.75
228 0.8
229 0.85
230 0.87