Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EEX4

Protein Details
Accession I3EEX4   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
77-102LSKFPCKLFHIKKNCRRKNCQFSHAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR045124  Su(sable)-like  
IPR041367  Znf-CCCH_4  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0045892  P:negative regulation of DNA-templated transcription  
GO:0016070  P:RNA metabolic process  
Pfam View protein in Pfam  
PF14608  zf-CCCH_2  
PF18044  zf-CCCH_4  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MAIIELPRLPRLSVPRFREPREIARNKRVKTSGAKDSSDENIMMKSMPYKPEKKHLCKYFVKNACIRGSNCTFSHDLSKFPCKLFHIKKNCRRKNCQFSHAPISDEEVRLLVSDGWELEKEEKEEVFISPFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.57
3 0.63
4 0.67
5 0.71
6 0.68
7 0.69
8 0.7
9 0.73
10 0.71
11 0.75
12 0.79
13 0.71
14 0.74
15 0.66
16 0.6
17 0.59
18 0.58
19 0.57
20 0.54
21 0.54
22 0.47
23 0.47
24 0.44
25 0.36
26 0.3
27 0.2
28 0.15
29 0.13
30 0.12
31 0.1
32 0.1
33 0.11
34 0.16
35 0.22
36 0.28
37 0.3
38 0.4
39 0.49
40 0.54
41 0.61
42 0.62
43 0.65
44 0.66
45 0.7
46 0.7
47 0.68
48 0.64
49 0.57
50 0.55
51 0.5
52 0.46
53 0.4
54 0.35
55 0.31
56 0.31
57 0.28
58 0.26
59 0.24
60 0.21
61 0.27
62 0.23
63 0.22
64 0.22
65 0.28
66 0.27
67 0.27
68 0.29
69 0.26
70 0.35
71 0.41
72 0.47
73 0.52
74 0.61
75 0.7
76 0.78
77 0.84
78 0.84
79 0.86
80 0.87
81 0.87
82 0.84
83 0.83
84 0.79
85 0.77
86 0.76
87 0.68
88 0.59
89 0.48
90 0.46
91 0.4
92 0.34
93 0.27
94 0.18
95 0.16
96 0.15
97 0.16
98 0.1
99 0.08
100 0.08
101 0.08
102 0.09
103 0.1
104 0.12
105 0.14
106 0.16
107 0.18
108 0.19
109 0.19
110 0.19
111 0.19
112 0.19