Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EJA3

Protein Details
Accession I3EJA3   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-29LPFVCFRKRELKTQRKARKSDSSIHydrophilic
NLS Segment(s)
PositionSequence
14-25RELKTQRKARKS
Subcellular Location(s) mito 17.5, mito_nucl 13.5, nucl 8.5
Family & Domain DBs
Amino Acid Sequences MPADTLPFVCFRKRELKTQRKARKSDSSIEKIKKIKVDLQMMRRLTELALQRDNYLSQHLTTIFSIFSICREMNKRLDIGVLNISETILRDILFTKIVSKSDLFYKKIPSFTNLYLCRKSIGSLRKLLKAGPPPENRLELTKKEIDYLNTYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.63
4 0.69
5 0.79
6 0.84
7 0.83
8 0.87
9 0.84
10 0.84
11 0.78
12 0.77
13 0.76
14 0.73
15 0.73
16 0.71
17 0.7
18 0.64
19 0.62
20 0.57
21 0.51
22 0.49
23 0.47
24 0.52
25 0.52
26 0.54
27 0.58
28 0.54
29 0.51
30 0.45
31 0.38
32 0.28
33 0.27
34 0.25
35 0.22
36 0.25
37 0.24
38 0.24
39 0.25
40 0.25
41 0.21
42 0.18
43 0.14
44 0.11
45 0.12
46 0.12
47 0.12
48 0.12
49 0.12
50 0.09
51 0.08
52 0.08
53 0.07
54 0.07
55 0.08
56 0.08
57 0.11
58 0.14
59 0.18
60 0.21
61 0.22
62 0.22
63 0.19
64 0.2
65 0.17
66 0.15
67 0.14
68 0.11
69 0.1
70 0.09
71 0.09
72 0.08
73 0.08
74 0.07
75 0.05
76 0.05
77 0.05
78 0.06
79 0.07
80 0.08
81 0.08
82 0.1
83 0.11
84 0.12
85 0.13
86 0.13
87 0.14
88 0.21
89 0.27
90 0.27
91 0.28
92 0.35
93 0.36
94 0.4
95 0.4
96 0.35
97 0.35
98 0.35
99 0.42
100 0.4
101 0.43
102 0.41
103 0.4
104 0.39
105 0.34
106 0.33
107 0.31
108 0.33
109 0.32
110 0.38
111 0.42
112 0.46
113 0.46
114 0.46
115 0.46
116 0.47
117 0.48
118 0.49
119 0.51
120 0.51
121 0.55
122 0.56
123 0.51
124 0.49
125 0.49
126 0.43
127 0.44
128 0.44
129 0.41
130 0.41
131 0.42
132 0.39