Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EHQ7

Protein Details
Accession I3EHQ7   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
117-139ETYSIKKDKYHIRNTRKRVGKSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.833, cyto_mito 5.333, cyto 5, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008628  GPP34-like  
IPR038261  GPP34-like_sf  
Gene Ontology GO:0005794  C:Golgi apparatus  
GO:0016020  C:membrane  
GO:0070273  F:phosphatidylinositol-4-phosphate binding  
Pfam View protein in Pfam  
PF05719  GPP34  
Amino Acid Sequences MDEFSPRRRDVKQENAFSSLKRLKTDLNLSEILVVFTTASGQLSIPGMYDPISMTLRALLLCELVLRGGITIDSSGIISVRDGYMFIDELHDEVYHNIKKAVNPKPIKSWLLLLNGETYSIKKDKYHIRNTRKRVGKSLVEKKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.65
3 0.63
4 0.55
5 0.54
6 0.5
7 0.43
8 0.36
9 0.35
10 0.32
11 0.38
12 0.46
13 0.4
14 0.38
15 0.36
16 0.34
17 0.34
18 0.31
19 0.24
20 0.16
21 0.13
22 0.07
23 0.06
24 0.07
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.05
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.06
80 0.07
81 0.12
82 0.13
83 0.13
84 0.15
85 0.16
86 0.2
87 0.28
88 0.36
89 0.4
90 0.44
91 0.46
92 0.52
93 0.57
94 0.55
95 0.48
96 0.44
97 0.39
98 0.39
99 0.36
100 0.29
101 0.26
102 0.24
103 0.24
104 0.2
105 0.16
106 0.16
107 0.17
108 0.18
109 0.17
110 0.25
111 0.34
112 0.44
113 0.54
114 0.6
115 0.69
116 0.78
117 0.84
118 0.87
119 0.86
120 0.81
121 0.79
122 0.76
123 0.75
124 0.76