Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EFV8

Protein Details
Accession I3EFV8    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-77ERCNKQQVPTKKEKLKHNLLHNHydrophilic
NLS Segment(s)
PositionSequence
25-31GKIKKRK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MKELIKELAYRILTEELASELKPSGKIKKRKQGMIKILCKLCNTQVNSVVFTKHLERCNKQQVPTKKEKLKHNLLHNIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.12
4 0.13
5 0.12
6 0.11
7 0.1
8 0.11
9 0.14
10 0.16
11 0.24
12 0.32
13 0.42
14 0.5
15 0.59
16 0.65
17 0.7
18 0.77
19 0.77
20 0.79
21 0.79
22 0.75
23 0.71
24 0.67
25 0.6
26 0.52
27 0.43
28 0.37
29 0.33
30 0.3
31 0.26
32 0.29
33 0.29
34 0.3
35 0.29
36 0.26
37 0.2
38 0.19
39 0.21
40 0.21
41 0.27
42 0.32
43 0.36
44 0.44
45 0.54
46 0.57
47 0.59
48 0.63
49 0.66
50 0.68
51 0.74
52 0.76
53 0.73
54 0.76
55 0.8
56 0.8
57 0.81
58 0.8
59 0.8