Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175VRE6

Protein Details
Accession A0A175VRE6   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
129-151ASSADWGKKARRRQRDMIKKMLEHydrophilic
NLS Segment(s)
PositionSequence
136-142KKARRRQ
Subcellular Location(s) cyto 17.5, cyto_nucl 13, nucl 5.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR036322  WD40_repeat_dom_sf  
Pfam View protein in Pfam  
PF07543  PGA2  
PROSITE View protein in PROSITE  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
Amino Acid Sequences SRLASASVDNTVKIWDPATGQCVATFEGHSNSVTIANVASTVGNRFSANLKATFTDLTPEKWIRVVIVAGFYLLLRPYLIKLGARSQMHAHEQDRAEPETEAKISPNELRGKIDIPEDTDDEDEASAEASSADWGKKARRRQRDMIKKMLEAEERRLQETREEEEDKDIEEFLIKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.12
3 0.14
4 0.16
5 0.18
6 0.18
7 0.17
8 0.17
9 0.18
10 0.18
11 0.16
12 0.15
13 0.14
14 0.14
15 0.15
16 0.15
17 0.14
18 0.13
19 0.13
20 0.12
21 0.1
22 0.08
23 0.07
24 0.06
25 0.06
26 0.06
27 0.06
28 0.07
29 0.08
30 0.09
31 0.09
32 0.1
33 0.12
34 0.16
35 0.17
36 0.17
37 0.17
38 0.17
39 0.19
40 0.18
41 0.16
42 0.16
43 0.15
44 0.15
45 0.19
46 0.19
47 0.19
48 0.19
49 0.19
50 0.15
51 0.15
52 0.13
53 0.08
54 0.09
55 0.08
56 0.07
57 0.07
58 0.06
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.05
65 0.06
66 0.07
67 0.07
68 0.08
69 0.12
70 0.18
71 0.18
72 0.18
73 0.19
74 0.21
75 0.22
76 0.24
77 0.21
78 0.2
79 0.2
80 0.22
81 0.23
82 0.22
83 0.2
84 0.17
85 0.18
86 0.14
87 0.14
88 0.12
89 0.1
90 0.09
91 0.1
92 0.12
93 0.16
94 0.19
95 0.19
96 0.21
97 0.22
98 0.22
99 0.22
100 0.23
101 0.18
102 0.16
103 0.18
104 0.16
105 0.16
106 0.16
107 0.14
108 0.13
109 0.12
110 0.09
111 0.07
112 0.06
113 0.05
114 0.04
115 0.04
116 0.04
117 0.05
118 0.06
119 0.07
120 0.08
121 0.1
122 0.18
123 0.25
124 0.36
125 0.45
126 0.54
127 0.62
128 0.71
129 0.8
130 0.84
131 0.85
132 0.85
133 0.8
134 0.71
135 0.66
136 0.62
137 0.58
138 0.5
139 0.5
140 0.47
141 0.44
142 0.45
143 0.43
144 0.38
145 0.37
146 0.38
147 0.37
148 0.36
149 0.37
150 0.35
151 0.38
152 0.38
153 0.33
154 0.3
155 0.24
156 0.17