Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175VRL8

Protein Details
Accession A0A175VRL8    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MASDKPTKRQKSDKDMPYNLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, cyto_nucl 9.833, nucl 7.5, cyto_pero 7.333, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004045  Glutathione_S-Trfase_N  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0016740  F:transferase activity  
PROSITE View protein in PROSITE  
PS50404  GST_NTER  
CDD cd03039  GST_N_Sigma_like  
Amino Acid Sequences MASDKPTKRQKSDKDMPYNLIYWPGIPGRGEHIRLVLEESGAEYTDTAHTKGGIDEVIAFVQGKVDDDDINPPLCAPPILKHGDLVINQTPNILLYLGPRLGLVPDADEDPDGLYRVNGLALTALDGLSNEPHDCHHPISTGLYYDMRTCPFVWAVIRVLQKSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.76
4 0.69
5 0.6
6 0.5
7 0.44
8 0.33
9 0.23
10 0.22
11 0.18
12 0.17
13 0.16
14 0.16
15 0.19
16 0.23
17 0.25
18 0.22
19 0.23
20 0.22
21 0.22
22 0.24
23 0.18
24 0.13
25 0.11
26 0.11
27 0.1
28 0.09
29 0.09
30 0.06
31 0.07
32 0.1
33 0.11
34 0.1
35 0.1
36 0.1
37 0.11
38 0.11
39 0.11
40 0.08
41 0.07
42 0.06
43 0.07
44 0.06
45 0.06
46 0.06
47 0.05
48 0.06
49 0.05
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.1
56 0.11
57 0.11
58 0.1
59 0.09
60 0.09
61 0.09
62 0.08
63 0.07
64 0.07
65 0.12
66 0.15
67 0.15
68 0.15
69 0.16
70 0.18
71 0.17
72 0.19
73 0.16
74 0.14
75 0.14
76 0.14
77 0.13
78 0.11
79 0.11
80 0.07
81 0.05
82 0.05
83 0.08
84 0.08
85 0.08
86 0.07
87 0.07
88 0.07
89 0.08
90 0.07
91 0.05
92 0.06
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.07
99 0.07
100 0.06
101 0.05
102 0.05
103 0.05
104 0.06
105 0.05
106 0.04
107 0.05
108 0.05
109 0.06
110 0.06
111 0.05
112 0.05
113 0.05
114 0.06
115 0.07
116 0.08
117 0.07
118 0.07
119 0.09
120 0.13
121 0.16
122 0.18
123 0.18
124 0.18
125 0.19
126 0.23
127 0.22
128 0.2
129 0.2
130 0.19
131 0.18
132 0.2
133 0.21
134 0.2
135 0.21
136 0.2
137 0.21
138 0.2
139 0.22
140 0.21
141 0.21
142 0.22
143 0.26
144 0.3