Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I3EFG6

Protein Details
Accession I3EFG6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-37FQIVETEKKRKRIKTRKYPKQEETHTDHydrophilic
NLS Segment(s)
PositionSequence
18-27KKRKRIKTRK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MEVQEVRNEAFQIVETEKKRKRIKTRKYPKQEETHTDTYIQPKSMPISEYISNSTNINHKIYRDVLINRRNGERVTALNLLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.32
4 0.37
5 0.46
6 0.53
7 0.59
8 0.68
9 0.71
10 0.79
11 0.81
12 0.88
13 0.89
14 0.93
15 0.93
16 0.89
17 0.88
18 0.83
19 0.78
20 0.75
21 0.68
22 0.58
23 0.5
24 0.43
25 0.39
26 0.34
27 0.27
28 0.19
29 0.16
30 0.17
31 0.16
32 0.15
33 0.12
34 0.15
35 0.16
36 0.17
37 0.19
38 0.19
39 0.18
40 0.18
41 0.18
42 0.19
43 0.2
44 0.22
45 0.2
46 0.2
47 0.23
48 0.25
49 0.26
50 0.27
51 0.31
52 0.37
53 0.42
54 0.46
55 0.46
56 0.48
57 0.48
58 0.43
59 0.4
60 0.34
61 0.3
62 0.31