Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A175WCL6

Protein Details
Accession A0A175WCL6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
32-51ESIRIRRRGRQNGARRHSKGBasic
NLS Segment(s)
PositionSequence
35-53RIRRRGRQNGARRHSKGSR
Subcellular Location(s) extr 12, plas 9, vacu 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQEQNITIGIIVGVVLAVFLACVCYFLYRYGESIRIRRRGRQNGARRHSKGSRGSGGSGFSGLSGESATVSAAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.03
8 0.03
9 0.04
10 0.04
11 0.06
12 0.07
13 0.09
14 0.11
15 0.11
16 0.13
17 0.13
18 0.19
19 0.21
20 0.27
21 0.32
22 0.39
23 0.4
24 0.46
25 0.54
26 0.57
27 0.64
28 0.67
29 0.7
30 0.72
31 0.78
32 0.8
33 0.73
34 0.71
35 0.67
36 0.65
37 0.62
38 0.57
39 0.56
40 0.49
41 0.48
42 0.42
43 0.39
44 0.32
45 0.25
46 0.19
47 0.12
48 0.1
49 0.08
50 0.07
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05