Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175VY86

Protein Details
Accession A0A175VY86    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
13-35IVSGRRGRWGRKRTRQHAGLRAHBasic
NLS Segment(s)
PositionSequence
17-36RRGRWGRKRTRQHAGLRAHR
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MSVPATYVMTAAIVSGRRGRWGRKRTRQHAGLRAHRKLVTEAAEERDYGADRAGVPAEEDGRTRSGRSRVERLVRREGLRVLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.14
4 0.2
5 0.24
6 0.32
7 0.4
8 0.5
9 0.59
10 0.66
11 0.76
12 0.78
13 0.84
14 0.84
15 0.83
16 0.81
17 0.79
18 0.79
19 0.76
20 0.71
21 0.64
22 0.57
23 0.49
24 0.42
25 0.36
26 0.28
27 0.21
28 0.2
29 0.2
30 0.2
31 0.18
32 0.17
33 0.15
34 0.13
35 0.11
36 0.1
37 0.07
38 0.07
39 0.08
40 0.08
41 0.07
42 0.07
43 0.07
44 0.09
45 0.09
46 0.09
47 0.1
48 0.13
49 0.14
50 0.15
51 0.2
52 0.25
53 0.33
54 0.38
55 0.45
56 0.5
57 0.6
58 0.67
59 0.68
60 0.71
61 0.69
62 0.65
63 0.62