Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I3EJS4

Protein Details
Accession I3EJS4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
55-77KGSTEKIKKERNKINKIIREAKRBasic
NLS Segment(s)
PositionSequence
60-73KIKKERNKINKIIR
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MRVEEDKKKYLTEKYTLLNEECVIIPEFISHCIINKVFYTHRVINHGNKPGIEIKGSTEKIKKERNKINKIIREAKRIYTISNKLHNILHNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.47
4 0.44
5 0.37
6 0.31
7 0.27
8 0.23
9 0.2
10 0.16
11 0.12
12 0.11
13 0.1
14 0.11
15 0.11
16 0.12
17 0.1
18 0.1
19 0.13
20 0.13
21 0.13
22 0.13
23 0.15
24 0.14
25 0.16
26 0.22
27 0.22
28 0.23
29 0.27
30 0.29
31 0.33
32 0.37
33 0.4
34 0.34
35 0.31
36 0.32
37 0.3
38 0.28
39 0.22
40 0.17
41 0.15
42 0.22
43 0.23
44 0.24
45 0.25
46 0.29
47 0.36
48 0.45
49 0.5
50 0.52
51 0.61
52 0.69
53 0.74
54 0.79
55 0.82
56 0.8
57 0.81
58 0.82
59 0.77
60 0.75
61 0.69
62 0.64
63 0.61
64 0.54
65 0.5
66 0.49
67 0.51
68 0.49
69 0.55
70 0.53
71 0.48
72 0.51