Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EHQ2

Protein Details
Accession I3EHQ2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-92ILVKPSNSRIPKKKTIEKKKNIHydrophilic
NLS Segment(s)
PositionSequence
79-91RIPKKKTIEKKKN
Subcellular Location(s) extr 17, mito 3, pero 2, E.R. 2, golg 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGVPSKTGKIIIVSIIALVIILVIAAVFCLSGGDNKVKGQKHQSKIPIRYSNVKSTNSIGTMTEIGQNEIILVKPSNSRIPKKKTIEKKKNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.07
5 0.05
6 0.04
7 0.02
8 0.02
9 0.02
10 0.02
11 0.01
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.03
18 0.04
19 0.06
20 0.08
21 0.09
22 0.11
23 0.18
24 0.18
25 0.21
26 0.31
27 0.38
28 0.4
29 0.46
30 0.54
31 0.56
32 0.61
33 0.66
34 0.62
35 0.56
36 0.6
37 0.57
38 0.57
39 0.53
40 0.49
41 0.42
42 0.38
43 0.38
44 0.3
45 0.27
46 0.18
47 0.15
48 0.14
49 0.13
50 0.15
51 0.13
52 0.13
53 0.13
54 0.12
55 0.11
56 0.1
57 0.1
58 0.08
59 0.08
60 0.09
61 0.12
62 0.15
63 0.24
64 0.31
65 0.4
66 0.48
67 0.56
68 0.65
69 0.72
70 0.79
71 0.82
72 0.86