Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I3EGH6

Protein Details
Accession I3EGH6    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-63VQKKRMSLCKYKKIKKKCGSKEKEKRQIRNQIEEHBasic
NLS Segment(s)
PositionSequence
23-70KRKGKVVQKKRMSLCKYKKIKKKCGSKEKEKRQIRNQIEEHLKEKSKR
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MVKIINISFFYIKQLMVQGVLSKRKGKVVQKKRMSLCKYKKIKKKCGSKEKEKRQIRNQIEEHLKEKSKRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.14
5 0.15
6 0.19
7 0.24
8 0.25
9 0.27
10 0.27
11 0.32
12 0.39
13 0.43
14 0.49
15 0.55
16 0.63
17 0.68
18 0.74
19 0.74
20 0.77
21 0.73
22 0.72
23 0.7
24 0.7
25 0.72
26 0.73
27 0.77
28 0.78
29 0.83
30 0.82
31 0.84
32 0.85
33 0.86
34 0.87
35 0.89
36 0.9
37 0.9
38 0.92
39 0.9
40 0.89
41 0.88
42 0.89
43 0.85
44 0.84
45 0.75
46 0.74
47 0.73
48 0.68
49 0.61
50 0.58
51 0.58