Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EE36

Protein Details
Accession I3EE36   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MEVKEKKKTKRKQAHQNTYAFRHNHydrophilic
40-69GLCRRCNEKIEWRKKYRKYKIQTHVSRCTVHydrophilic
NLS Segment(s)
PositionSequence
6-12KKKTKRK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019351  DUF2039  
Pfam View protein in Pfam  
PF10217  DUF2039  
Amino Acid Sequences MEVKEKKKTKRKQAHQNTYAFRHNPNSMLTKEIAAIKIFGLCRRCNEKIEWRKKYRKYKIQTHVSRCTVCLNKSITTAYNIVCEPCGEGKKICRICRVGLCFETCAPLEQVLEKKKESATISTPESNNIDLEVNVSCDEESAVSIDQSEIDTDQSELEQETL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.91
4 0.86
5 0.81
6 0.78
7 0.69
8 0.61
9 0.56
10 0.5
11 0.43
12 0.4
13 0.39
14 0.31
15 0.33
16 0.3
17 0.24
18 0.24
19 0.24
20 0.21
21 0.17
22 0.16
23 0.13
24 0.16
25 0.16
26 0.18
27 0.2
28 0.2
29 0.25
30 0.33
31 0.35
32 0.35
33 0.4
34 0.47
35 0.54
36 0.63
37 0.67
38 0.69
39 0.76
40 0.83
41 0.88
42 0.88
43 0.87
44 0.85
45 0.85
46 0.86
47 0.87
48 0.86
49 0.83
50 0.81
51 0.75
52 0.66
53 0.56
54 0.52
55 0.45
56 0.37
57 0.34
58 0.28
59 0.25
60 0.25
61 0.26
62 0.2
63 0.19
64 0.2
65 0.15
66 0.14
67 0.13
68 0.12
69 0.11
70 0.1
71 0.09
72 0.1
73 0.11
74 0.1
75 0.11
76 0.14
77 0.23
78 0.29
79 0.3
80 0.33
81 0.34
82 0.37
83 0.42
84 0.44
85 0.39
86 0.35
87 0.34
88 0.3
89 0.27
90 0.26
91 0.19
92 0.16
93 0.13
94 0.12
95 0.1
96 0.12
97 0.18
98 0.21
99 0.24
100 0.23
101 0.24
102 0.24
103 0.28
104 0.28
105 0.26
106 0.26
107 0.27
108 0.31
109 0.34
110 0.34
111 0.32
112 0.32
113 0.28
114 0.24
115 0.21
116 0.17
117 0.12
118 0.13
119 0.11
120 0.1
121 0.1
122 0.1
123 0.09
124 0.08
125 0.08
126 0.07
127 0.07
128 0.08
129 0.08
130 0.07
131 0.08
132 0.08
133 0.08
134 0.08
135 0.09
136 0.08
137 0.08
138 0.09
139 0.09
140 0.1
141 0.09
142 0.1