Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175VRL7

Protein Details
Accession A0A175VRL7    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-84SYDREKGWDRDRKYKRRRRRSAEEGKGFLLBasic
NLS Segment(s)
PositionSequence
59-76EKGWDRDRKYKRRRRRSA
Subcellular Location(s) nucl 8.5, cyto_nucl 7.333, cyto 5, plas 5, cyto_mito 4.833, mito 3.5, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSELSRLFPRNDDNQQMLVCTKRLDDSVVNDSDVEEYVIYPRGYSEPRHRPRGYSYDREKGWDRDRKYKRRRRRSAEEGKGFLLAVLGFLVGLVLCSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.39
4 0.35
5 0.29
6 0.24
7 0.19
8 0.16
9 0.15
10 0.15
11 0.17
12 0.17
13 0.19
14 0.24
15 0.24
16 0.23
17 0.21
18 0.21
19 0.18
20 0.16
21 0.12
22 0.06
23 0.05
24 0.06
25 0.09
26 0.09
27 0.08
28 0.08
29 0.1
30 0.12
31 0.15
32 0.24
33 0.32
34 0.38
35 0.47
36 0.46
37 0.46
38 0.5
39 0.56
40 0.53
41 0.51
42 0.52
43 0.51
44 0.51
45 0.52
46 0.51
47 0.48
48 0.51
49 0.49
50 0.48
51 0.52
52 0.62
53 0.69
54 0.77
55 0.81
56 0.83
57 0.86
58 0.92
59 0.91
60 0.91
61 0.92
62 0.92
63 0.92
64 0.89
65 0.8
66 0.7
67 0.61
68 0.5
69 0.39
70 0.29
71 0.17
72 0.09
73 0.06
74 0.05
75 0.04
76 0.04
77 0.04
78 0.03