Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177UJZ4

Protein Details
Accession A0A177UJZ4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTKKRRNAGRSKHGRGHVPFBasic
NLS Segment(s)
PositionSequence
4-14KRRNAGRSKHG
88-103SREGRRNRAPPVRVRY
Subcellular Location(s) mito 16, nucl 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MTKKRRNAGRSKHGRGHVPFVRCSNCARACPKDKAIKRFTVRNIVEAAAIRDMSEASVYQEYALPKLYIKLHYCVSCAIHAHIVRVRSREGRRNRAPPVRVRYNKDGKKINPAVASAQTAAAAPAGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.74
3 0.72
4 0.68
5 0.61
6 0.56
7 0.53
8 0.51
9 0.44
10 0.43
11 0.43
12 0.4
13 0.42
14 0.44
15 0.47
16 0.5
17 0.55
18 0.59
19 0.6
20 0.63
21 0.66
22 0.67
23 0.67
24 0.65
25 0.66
26 0.63
27 0.63
28 0.57
29 0.5
30 0.45
31 0.36
32 0.33
33 0.26
34 0.22
35 0.13
36 0.12
37 0.1
38 0.08
39 0.08
40 0.06
41 0.06
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.09
48 0.09
49 0.09
50 0.1
51 0.08
52 0.08
53 0.1
54 0.12
55 0.14
56 0.16
57 0.18
58 0.2
59 0.2
60 0.21
61 0.2
62 0.2
63 0.17
64 0.16
65 0.15
66 0.17
67 0.16
68 0.18
69 0.18
70 0.2
71 0.21
72 0.22
73 0.24
74 0.27
75 0.33
76 0.4
77 0.48
78 0.55
79 0.61
80 0.67
81 0.73
82 0.74
83 0.74
84 0.74
85 0.74
86 0.75
87 0.73
88 0.73
89 0.74
90 0.76
91 0.76
92 0.75
93 0.75
94 0.67
95 0.7
96 0.68
97 0.64
98 0.56
99 0.51
100 0.47
101 0.41
102 0.4
103 0.3
104 0.25
105 0.2
106 0.17
107 0.15
108 0.13