Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I3EI14

Protein Details
Accession I3EI14    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-24AIRTPRRAAAHKRTPYKQRVHDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038608  Csm1/Pcs1_C_sf  
IPR031519  DUF5094  
Pfam View protein in Pfam  
PF17015  DUF5094  
Amino Acid Sequences MAIRTPRRAAAHKRTPYKQRVHDVVNENPLPNSNLIDLIKYYKEKEQIREEYITALKQENAYLRSNLAVPDQSSFTGLKISKTGDIFNCKQTIEKEGVTCSITFLLEEHEHIYVYTYKESKNVRDLPEYLQRTINFPKTQVKIFFFNIYQCVAKDEDEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.84
4 0.83
5 0.81
6 0.8
7 0.77
8 0.73
9 0.73
10 0.69
11 0.65
12 0.63
13 0.56
14 0.47
15 0.41
16 0.38
17 0.31
18 0.25
19 0.21
20 0.13
21 0.15
22 0.14
23 0.15
24 0.14
25 0.16
26 0.18
27 0.18
28 0.2
29 0.21
30 0.28
31 0.32
32 0.37
33 0.43
34 0.45
35 0.48
36 0.48
37 0.44
38 0.39
39 0.36
40 0.3
41 0.23
42 0.18
43 0.15
44 0.13
45 0.15
46 0.15
47 0.16
48 0.17
49 0.17
50 0.16
51 0.16
52 0.16
53 0.15
54 0.12
55 0.1
56 0.09
57 0.1
58 0.1
59 0.1
60 0.11
61 0.1
62 0.09
63 0.12
64 0.12
65 0.12
66 0.12
67 0.13
68 0.14
69 0.14
70 0.16
71 0.14
72 0.2
73 0.21
74 0.23
75 0.23
76 0.21
77 0.22
78 0.21
79 0.21
80 0.18
81 0.18
82 0.16
83 0.16
84 0.17
85 0.16
86 0.15
87 0.13
88 0.1
89 0.09
90 0.08
91 0.07
92 0.1
93 0.09
94 0.1
95 0.11
96 0.1
97 0.1
98 0.1
99 0.12
100 0.11
101 0.12
102 0.15
103 0.16
104 0.16
105 0.22
106 0.25
107 0.27
108 0.33
109 0.38
110 0.38
111 0.42
112 0.43
113 0.43
114 0.49
115 0.49
116 0.42
117 0.41
118 0.37
119 0.38
120 0.42
121 0.45
122 0.36
123 0.36
124 0.43
125 0.41
126 0.47
127 0.48
128 0.46
129 0.43
130 0.45
131 0.46
132 0.39
133 0.38
134 0.34
135 0.31
136 0.29
137 0.24
138 0.23
139 0.2
140 0.2
141 0.19