Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177UZ49

Protein Details
Accession A0A177UZ49   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
235-254ESHLKTPRPTSPTRRKGGKKBasic
NLS Segment(s)
PositionSequence
244-254TSPTRRKGGKK
Subcellular Location(s) extr 19, mito 3, golg 3
Family & Domain DBs
Amino Acid Sequences MRTTAILPAACLLLLSLASTSLASALETEPELNILTTFANDFNIVRNGAANRVVLSITNPADRAISLEGITGAFLNKNKKDGQKGRVLRNMTTQPFKSLPLPPKRSKPLQVPFNMYPEFKPGDVEIELRVLITDNGSSRKYNLNAYQGTVKVEEPPKQWFDLQLLSLYAMLAAGLAYAGYVGLSTYIMPPQQSKRDAARAAKKAEAPAAPAPAPAAAASSSATSAGGYQEEWIPESHLKTPRPTSPTRRKGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.06
6 0.06
7 0.06
8 0.05
9 0.06
10 0.05
11 0.07
12 0.07
13 0.08
14 0.08
15 0.09
16 0.08
17 0.09
18 0.09
19 0.08
20 0.08
21 0.07
22 0.07
23 0.07
24 0.08
25 0.08
26 0.08
27 0.09
28 0.09
29 0.12
30 0.14
31 0.14
32 0.13
33 0.16
34 0.15
35 0.17
36 0.19
37 0.16
38 0.14
39 0.14
40 0.14
41 0.12
42 0.12
43 0.15
44 0.15
45 0.15
46 0.15
47 0.14
48 0.15
49 0.14
50 0.15
51 0.12
52 0.11
53 0.1
54 0.1
55 0.09
56 0.09
57 0.09
58 0.07
59 0.06
60 0.07
61 0.1
62 0.16
63 0.17
64 0.21
65 0.25
66 0.3
67 0.4
68 0.46
69 0.49
70 0.53
71 0.59
72 0.63
73 0.65
74 0.63
75 0.54
76 0.53
77 0.54
78 0.47
79 0.45
80 0.38
81 0.35
82 0.34
83 0.34
84 0.31
85 0.31
86 0.36
87 0.41
88 0.48
89 0.49
90 0.56
91 0.6
92 0.62
93 0.61
94 0.62
95 0.6
96 0.6
97 0.59
98 0.58
99 0.54
100 0.53
101 0.49
102 0.4
103 0.31
104 0.27
105 0.24
106 0.17
107 0.16
108 0.11
109 0.12
110 0.12
111 0.12
112 0.1
113 0.09
114 0.09
115 0.08
116 0.08
117 0.06
118 0.05
119 0.05
120 0.05
121 0.05
122 0.08
123 0.1
124 0.1
125 0.11
126 0.15
127 0.16
128 0.2
129 0.22
130 0.26
131 0.25
132 0.27
133 0.28
134 0.25
135 0.25
136 0.22
137 0.18
138 0.17
139 0.2
140 0.23
141 0.21
142 0.25
143 0.26
144 0.26
145 0.26
146 0.22
147 0.22
148 0.2
149 0.19
150 0.15
151 0.13
152 0.12
153 0.12
154 0.1
155 0.07
156 0.05
157 0.04
158 0.03
159 0.03
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.03
171 0.03
172 0.04
173 0.06
174 0.07
175 0.08
176 0.12
177 0.18
178 0.25
179 0.27
180 0.3
181 0.35
182 0.42
183 0.47
184 0.52
185 0.56
186 0.55
187 0.57
188 0.56
189 0.53
190 0.48
191 0.46
192 0.39
193 0.34
194 0.3
195 0.3
196 0.26
197 0.24
198 0.22
199 0.17
200 0.17
201 0.12
202 0.1
203 0.07
204 0.07
205 0.08
206 0.08
207 0.08
208 0.08
209 0.08
210 0.07
211 0.07
212 0.08
213 0.08
214 0.07
215 0.08
216 0.11
217 0.12
218 0.13
219 0.13
220 0.15
221 0.18
222 0.21
223 0.26
224 0.31
225 0.34
226 0.4
227 0.46
228 0.5
229 0.54
230 0.6
231 0.64
232 0.68
233 0.75
234 0.77