Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177TZQ4

Protein Details
Accession A0A177TZQ4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
136-161AAGAARRRTTRSRRARNRTSQDQGPQHydrophilic
NLS Segment(s)
PositionSequence
140-151ARRRTTRSRRAR
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
Amino Acid Sequences YGASRPARERRRQTLGQEDGCTVLKPRTVKGRYSVRWARKQEPPPTGMARPARQDYTTRTVSDEEPDGKRGLTGKVLTGPGLLETDGKTNNTTGKRISATAAGDNSGGKTQDTRRLGVRRERMVLARAVKAHFLLAAGAARRRTTRSRRARNRTSQDQGPQPFRDGLAGAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.76
3 0.71
4 0.63
5 0.55
6 0.49
7 0.43
8 0.36
9 0.27
10 0.21
11 0.19
12 0.19
13 0.22
14 0.3
15 0.33
16 0.36
17 0.42
18 0.5
19 0.5
20 0.58
21 0.64
22 0.62
23 0.69
24 0.72
25 0.7
26 0.69
27 0.74
28 0.73
29 0.69
30 0.62
31 0.57
32 0.56
33 0.51
34 0.48
35 0.45
36 0.4
37 0.39
38 0.4
39 0.37
40 0.34
41 0.35
42 0.34
43 0.35
44 0.34
45 0.3
46 0.28
47 0.28
48 0.27
49 0.26
50 0.23
51 0.2
52 0.19
53 0.2
54 0.19
55 0.17
56 0.17
57 0.16
58 0.14
59 0.14
60 0.13
61 0.12
62 0.14
63 0.15
64 0.14
65 0.12
66 0.11
67 0.08
68 0.08
69 0.08
70 0.05
71 0.05
72 0.07
73 0.07
74 0.08
75 0.08
76 0.08
77 0.14
78 0.15
79 0.15
80 0.15
81 0.17
82 0.18
83 0.18
84 0.18
85 0.16
86 0.16
87 0.16
88 0.16
89 0.13
90 0.12
91 0.12
92 0.11
93 0.1
94 0.09
95 0.07
96 0.1
97 0.12
98 0.2
99 0.22
100 0.24
101 0.29
102 0.35
103 0.4
104 0.46
105 0.51
106 0.47
107 0.49
108 0.49
109 0.45
110 0.42
111 0.41
112 0.36
113 0.31
114 0.29
115 0.27
116 0.25
117 0.23
118 0.21
119 0.15
120 0.12
121 0.09
122 0.08
123 0.1
124 0.1
125 0.13
126 0.14
127 0.16
128 0.18
129 0.23
130 0.31
131 0.38
132 0.47
133 0.56
134 0.66
135 0.75
136 0.84
137 0.9
138 0.91
139 0.91
140 0.9
141 0.87
142 0.83
143 0.8
144 0.79
145 0.76
146 0.72
147 0.65
148 0.58
149 0.52
150 0.45
151 0.39