Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177V042

Protein Details
Accession A0A177V042    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MATKRKKTTQAPQTAKRAPPRCRKGCKDSAHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MATKRKKTTQAPQTAKRAPPRCRKGCKDSAHPTLGALKADCACSQGQIPNPAELATTPDHLLPSAFTSPVEYRRRCVSLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.77
4 0.76
5 0.75
6 0.76
7 0.79
8 0.79
9 0.82
10 0.83
11 0.82
12 0.82
13 0.8
14 0.79
15 0.76
16 0.73
17 0.66
18 0.58
19 0.49
20 0.43
21 0.37
22 0.28
23 0.19
24 0.14
25 0.12
26 0.13
27 0.12
28 0.1
29 0.09
30 0.09
31 0.1
32 0.12
33 0.14
34 0.19
35 0.2
36 0.19
37 0.2
38 0.19
39 0.18
40 0.15
41 0.16
42 0.11
43 0.12
44 0.11
45 0.12
46 0.12
47 0.12
48 0.12
49 0.09
50 0.12
51 0.12
52 0.12
53 0.11
54 0.16
55 0.19
56 0.28
57 0.36
58 0.34
59 0.36
60 0.43