Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EFH3

Protein Details
Accession I3EFH3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
56-78IPMSKKSSKKGSSKPTKKQESSSHydrophilic
NLS Segment(s)
PositionSequence
61-70KSSKKGSSKP
Subcellular Location(s) mito 9, extr 6, pero 3, nucl 2, plas 2, E.R. 2, golg 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MSIKHLLKIQVFILCILIHCTKNISALNLPILNESNPKKPSSLSLPIGDFSSDEVIPMSKKSSKKGSSKPTKKQESSSSDVESTEGVKSKGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.17
4 0.18
5 0.15
6 0.15
7 0.17
8 0.16
9 0.2
10 0.21
11 0.19
12 0.17
13 0.18
14 0.21
15 0.2
16 0.2
17 0.17
18 0.17
19 0.14
20 0.19
21 0.2
22 0.23
23 0.24
24 0.24
25 0.24
26 0.23
27 0.26
28 0.27
29 0.31
30 0.27
31 0.27
32 0.27
33 0.27
34 0.27
35 0.23
36 0.16
37 0.11
38 0.1
39 0.08
40 0.07
41 0.07
42 0.07
43 0.07
44 0.08
45 0.1
46 0.14
47 0.16
48 0.21
49 0.3
50 0.37
51 0.46
52 0.55
53 0.63
54 0.69
55 0.77
56 0.83
57 0.84
58 0.87
59 0.82
60 0.79
61 0.78
62 0.74
63 0.69
64 0.64
65 0.57
66 0.48
67 0.44
68 0.38
69 0.29
70 0.23
71 0.2
72 0.18
73 0.14