Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177UNK4

Protein Details
Accession A0A177UNK4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRQKRAKQYRRLLQQYQLHFHydrophilic
204-246APSSSAPTPQPKKRKAKAPNPLSVKKKKPSKPNAPAKRGTGKPHydrophilic
NLS Segment(s)
PositionSequence
213-248QPKKRKAKAPNPLSVKKKKPSKPNAPAKRGTGKPPK
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
Amino Acid Sequences MRQKRAKQYRRLLQQYQLHFNFRAPFQLLLDDTLTLHLAKESSGPNSPSPLSRLSEILQQPADPQHVKLMITQCSMVSLYNLEKSPDPSQAILAKRAVGLAKEFERRRCNHREAIETDVCIAECVGGSNKHRYILGTGRLKLRTGVGKECVGLPVVHPNETGVLVMAPMSEATKARVDELERAALKGPATAPLPENVITGPTPAPSSSAPTPQPKKRKAKAPNPLSVKKKKPSKPNAPAKRGTGKPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.77
3 0.76
4 0.69
5 0.63
6 0.55
7 0.53
8 0.48
9 0.4
10 0.38
11 0.3
12 0.28
13 0.25
14 0.28
15 0.25
16 0.23
17 0.23
18 0.18
19 0.15
20 0.15
21 0.14
22 0.1
23 0.1
24 0.08
25 0.08
26 0.08
27 0.11
28 0.12
29 0.15
30 0.19
31 0.22
32 0.22
33 0.25
34 0.26
35 0.24
36 0.25
37 0.26
38 0.23
39 0.22
40 0.23
41 0.21
42 0.28
43 0.27
44 0.28
45 0.25
46 0.23
47 0.23
48 0.23
49 0.27
50 0.19
51 0.19
52 0.19
53 0.2
54 0.2
55 0.23
56 0.25
57 0.23
58 0.23
59 0.23
60 0.19
61 0.18
62 0.18
63 0.14
64 0.1
65 0.09
66 0.09
67 0.12
68 0.13
69 0.13
70 0.13
71 0.17
72 0.19
73 0.21
74 0.21
75 0.18
76 0.2
77 0.25
78 0.25
79 0.24
80 0.22
81 0.19
82 0.18
83 0.18
84 0.16
85 0.11
86 0.11
87 0.11
88 0.14
89 0.21
90 0.23
91 0.28
92 0.34
93 0.36
94 0.42
95 0.47
96 0.49
97 0.48
98 0.5
99 0.49
100 0.45
101 0.5
102 0.44
103 0.36
104 0.31
105 0.25
106 0.21
107 0.15
108 0.12
109 0.05
110 0.04
111 0.04
112 0.05
113 0.07
114 0.09
115 0.14
116 0.14
117 0.15
118 0.15
119 0.15
120 0.17
121 0.2
122 0.26
123 0.27
124 0.28
125 0.32
126 0.33
127 0.32
128 0.3
129 0.27
130 0.25
131 0.22
132 0.23
133 0.22
134 0.22
135 0.22
136 0.22
137 0.19
138 0.15
139 0.12
140 0.1
141 0.15
142 0.16
143 0.16
144 0.15
145 0.15
146 0.15
147 0.15
148 0.14
149 0.06
150 0.05
151 0.05
152 0.05
153 0.04
154 0.03
155 0.03
156 0.04
157 0.05
158 0.05
159 0.07
160 0.11
161 0.11
162 0.12
163 0.14
164 0.16
165 0.2
166 0.21
167 0.26
168 0.23
169 0.23
170 0.23
171 0.22
172 0.21
173 0.18
174 0.16
175 0.13
176 0.14
177 0.15
178 0.15
179 0.15
180 0.17
181 0.16
182 0.16
183 0.13
184 0.13
185 0.12
186 0.12
187 0.12
188 0.1
189 0.11
190 0.1
191 0.13
192 0.12
193 0.17
194 0.19
195 0.24
196 0.29
197 0.38
198 0.46
199 0.54
200 0.63
201 0.68
202 0.76
203 0.78
204 0.83
205 0.84
206 0.86
207 0.88
208 0.87
209 0.86
210 0.85
211 0.85
212 0.85
213 0.84
214 0.82
215 0.81
216 0.82
217 0.81
218 0.83
219 0.85
220 0.87
221 0.87
222 0.89
223 0.91
224 0.89
225 0.88
226 0.84
227 0.83
228 0.76