Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EK33

Protein Details
Accession I3EK33   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MVNYPKTRKTHCQKCNTHEVHKHydrophilic
65-92KVVLKMECSKCKRKQCKVFKRAKHVEIGHydrophilic
NLS Segment(s)
PositionSequence
27-66KKSKERPTAQGARRYARKQRGFGGQTKPILRRKAKTTKKV
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNYPKTRKTHCQKCNTHEVHKVSLYKKSKERPTAQGARRYARKQRGFGGQTKPILRRKAKTTKKVVLKMECSKCKRKQCKVFKRAKHVEIGAQKKAKGEALNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.81
4 0.77
5 0.75
6 0.69
7 0.64
8 0.59
9 0.58
10 0.49
11 0.53
12 0.52
13 0.5
14 0.53
15 0.57
16 0.61
17 0.64
18 0.68
19 0.66
20 0.69
21 0.72
22 0.7
23 0.7
24 0.65
25 0.62
26 0.63
27 0.61
28 0.6
29 0.6
30 0.6
31 0.55
32 0.55
33 0.58
34 0.54
35 0.55
36 0.53
37 0.47
38 0.45
39 0.45
40 0.46
41 0.43
42 0.47
43 0.45
44 0.43
45 0.47
46 0.54
47 0.6
48 0.64
49 0.67
50 0.68
51 0.73
52 0.76
53 0.74
54 0.7
55 0.68
56 0.69
57 0.69
58 0.7
59 0.67
60 0.69
61 0.71
62 0.75
63 0.78
64 0.8
65 0.81
66 0.84
67 0.89
68 0.9
69 0.92
70 0.9
71 0.91
72 0.9
73 0.83
74 0.78
75 0.69
76 0.67
77 0.66
78 0.64
79 0.61
80 0.56
81 0.53
82 0.48
83 0.48
84 0.44