Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177UKJ1

Protein Details
Accession A0A177UKJ1    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-60SKVFTFCKSKCHKNFKMKRNPRKVRWTKAFRKAAGHydrophilic
NLS Segment(s)
PositionSequence
41-59KMKRNPRKVRWTKAFRKAA
100-122KARRERAFYRARMAKAGNTKAAK
Subcellular Location(s) mito 15, cyto 7.5, cyto_nucl 6, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MRIQHCSFCSGPIYPGSGMCFVRGDSKVFTFCKSKCHKNFKMKRNPRKVRWTKAFRKAAGKEMTVDSTLEFEKRRNVPVRYNRDLVAATLAAMKRIQEIKARRERAFYRARMAKAGNTKAAKRVSNLAAVNRAEHLRGTIRADKERAVAERENLERVRVKVQERRKAAKSAMVKGDGQAMTMDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.23
5 0.22
6 0.21
7 0.19
8 0.17
9 0.22
10 0.22
11 0.22
12 0.21
13 0.23
14 0.27
15 0.28
16 0.3
17 0.31
18 0.3
19 0.38
20 0.43
21 0.51
22 0.56
23 0.65
24 0.72
25 0.76
26 0.86
27 0.86
28 0.9
29 0.91
30 0.92
31 0.92
32 0.93
33 0.91
34 0.92
35 0.91
36 0.9
37 0.9
38 0.89
39 0.88
40 0.88
41 0.87
42 0.79
43 0.79
44 0.71
45 0.68
46 0.62
47 0.53
48 0.44
49 0.38
50 0.35
51 0.26
52 0.24
53 0.15
54 0.13
55 0.13
56 0.12
57 0.11
58 0.1
59 0.17
60 0.19
61 0.25
62 0.3
63 0.32
64 0.4
65 0.49
66 0.57
67 0.55
68 0.55
69 0.49
70 0.44
71 0.41
72 0.32
73 0.23
74 0.14
75 0.1
76 0.11
77 0.1
78 0.09
79 0.09
80 0.08
81 0.09
82 0.11
83 0.12
84 0.16
85 0.21
86 0.29
87 0.39
88 0.44
89 0.42
90 0.46
91 0.47
92 0.48
93 0.52
94 0.45
95 0.44
96 0.45
97 0.45
98 0.42
99 0.41
100 0.38
101 0.38
102 0.38
103 0.36
104 0.34
105 0.34
106 0.37
107 0.4
108 0.37
109 0.31
110 0.34
111 0.29
112 0.33
113 0.34
114 0.29
115 0.31
116 0.3
117 0.28
118 0.25
119 0.23
120 0.17
121 0.16
122 0.16
123 0.13
124 0.15
125 0.2
126 0.24
127 0.28
128 0.32
129 0.34
130 0.33
131 0.33
132 0.34
133 0.31
134 0.3
135 0.28
136 0.26
137 0.31
138 0.31
139 0.34
140 0.31
141 0.32
142 0.32
143 0.32
144 0.35
145 0.34
146 0.39
147 0.42
148 0.52
149 0.58
150 0.62
151 0.68
152 0.66
153 0.67
154 0.63
155 0.63
156 0.6
157 0.59
158 0.57
159 0.53
160 0.49
161 0.43
162 0.48
163 0.39
164 0.33
165 0.24