Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177V3Z2

Protein Details
Accession A0A177V3Z2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-60PSKAPAKSGDKKKAKKVRKETYSTYHydrophilic
NLS Segment(s)
PositionSequence
18-54KAPSSSAGKAPVEAAKKAPSKAPAKSGDKKKAKKVRK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPPKSSIGGKAPASTGGKAPSSSAGKAPVEAAKKAPSKAPAKSGDKKKAKKVRKETYSTYIYRVLKQVHPDTGISNKAMAILNSFVQDIFERIASEASKLASYNKKSTISAREIQTAVRLILPGELSKHAISEGTKSVTKYSSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.25
4 0.25
5 0.23
6 0.23
7 0.24
8 0.24
9 0.25
10 0.24
11 0.26
12 0.24
13 0.25
14 0.26
15 0.24
16 0.24
17 0.24
18 0.25
19 0.27
20 0.3
21 0.3
22 0.32
23 0.35
24 0.37
25 0.39
26 0.44
27 0.45
28 0.5
29 0.58
30 0.64
31 0.67
32 0.71
33 0.74
34 0.78
35 0.79
36 0.81
37 0.82
38 0.83
39 0.83
40 0.82
41 0.82
42 0.77
43 0.73
44 0.7
45 0.61
46 0.53
47 0.49
48 0.42
49 0.37
50 0.35
51 0.31
52 0.27
53 0.31
54 0.31
55 0.25
56 0.25
57 0.24
58 0.22
59 0.21
60 0.2
61 0.15
62 0.13
63 0.11
64 0.11
65 0.11
66 0.1
67 0.08
68 0.08
69 0.08
70 0.09
71 0.09
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.06
79 0.07
80 0.08
81 0.08
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.14
88 0.2
89 0.23
90 0.27
91 0.31
92 0.33
93 0.34
94 0.38
95 0.41
96 0.4
97 0.42
98 0.4
99 0.4
100 0.38
101 0.37
102 0.35
103 0.29
104 0.23
105 0.18
106 0.15
107 0.11
108 0.13
109 0.13
110 0.11
111 0.12
112 0.13
113 0.15
114 0.15
115 0.15
116 0.14
117 0.15
118 0.15
119 0.17
120 0.19
121 0.21
122 0.23
123 0.24
124 0.27
125 0.27