Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EDQ8

Protein Details
Accession I3EDQ8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
119-145QGGVKPEQRNPRIKNKRRYQDAHNLAGHydrophilic
NLS Segment(s)
PositionSequence
127-136RNPRIKNKRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018972  Sas10_C_dom  
Pfam View protein in Pfam  
PF09368  Sas10  
Amino Acid Sequences MTVETEKYKELKFQNVDEVKAVLKQLNPEESSLKESLLRCYILNLIMYNQLEETHPIKKTLITLSVYIDLVDKASKAEQPAGSNIIKEAEEELMPEGPETHRRPIDFTIQKNRVHTEKQGGVKPEQRNPRIKNKRRYQDAHNLAGQIRKEYPKLHKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.48
4 0.42
5 0.39
6 0.3
7 0.28
8 0.26
9 0.18
10 0.17
11 0.2
12 0.22
13 0.27
14 0.27
15 0.27
16 0.28
17 0.27
18 0.31
19 0.26
20 0.23
21 0.22
22 0.22
23 0.24
24 0.24
25 0.24
26 0.19
27 0.2
28 0.2
29 0.17
30 0.17
31 0.14
32 0.12
33 0.15
34 0.15
35 0.14
36 0.12
37 0.12
38 0.11
39 0.14
40 0.15
41 0.15
42 0.16
43 0.16
44 0.17
45 0.17
46 0.19
47 0.18
48 0.19
49 0.16
50 0.17
51 0.17
52 0.18
53 0.17
54 0.15
55 0.13
56 0.09
57 0.08
58 0.07
59 0.06
60 0.05
61 0.06
62 0.07
63 0.07
64 0.1
65 0.11
66 0.12
67 0.13
68 0.16
69 0.16
70 0.15
71 0.14
72 0.12
73 0.11
74 0.1
75 0.1
76 0.07
77 0.07
78 0.07
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.15
86 0.17
87 0.22
88 0.23
89 0.24
90 0.27
91 0.29
92 0.38
93 0.37
94 0.41
95 0.46
96 0.5
97 0.52
98 0.51
99 0.52
100 0.46
101 0.43
102 0.41
103 0.39
104 0.4
105 0.43
106 0.45
107 0.45
108 0.45
109 0.5
110 0.52
111 0.52
112 0.55
113 0.57
114 0.62
115 0.64
116 0.71
117 0.74
118 0.79
119 0.82
120 0.82
121 0.86
122 0.86
123 0.86
124 0.83
125 0.83
126 0.8
127 0.75
128 0.67
129 0.59
130 0.51
131 0.5
132 0.42
133 0.35
134 0.33
135 0.31
136 0.32
137 0.37