Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177UPN8

Protein Details
Accession A0A177UPN8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-39SLKFKDGSGEKKKKKSKSSTSARLSEVHydrophilic
NLS Segment(s)
PositionSequence
17-29KDGSGEKKKKKSK
Subcellular Location(s) nucl 21, mito_nucl 12.833, cyto_nucl 11.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MGEDAYAFKPGGSLKFKDGSGEKKKKKSKSSTSARLSEVKASASSSSATPQASSSSSSSSKPSGSTAAEERASSSEPLSLERTDAERRFDEIQRKRLVEKVKSEAKKSHKDKVDKFNTYLESLSEHYDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.31
4 0.35
5 0.37
6 0.4
7 0.46
8 0.55
9 0.59
10 0.65
11 0.74
12 0.78
13 0.84
14 0.84
15 0.84
16 0.84
17 0.86
18 0.86
19 0.85
20 0.8
21 0.73
22 0.67
23 0.58
24 0.51
25 0.41
26 0.32
27 0.25
28 0.21
29 0.18
30 0.14
31 0.14
32 0.1
33 0.11
34 0.12
35 0.11
36 0.1
37 0.1
38 0.11
39 0.11
40 0.13
41 0.12
42 0.14
43 0.15
44 0.16
45 0.17
46 0.17
47 0.17
48 0.15
49 0.15
50 0.14
51 0.13
52 0.14
53 0.14
54 0.15
55 0.15
56 0.15
57 0.14
58 0.13
59 0.14
60 0.12
61 0.1
62 0.09
63 0.09
64 0.11
65 0.13
66 0.12
67 0.11
68 0.12
69 0.15
70 0.19
71 0.2
72 0.22
73 0.2
74 0.23
75 0.27
76 0.31
77 0.38
78 0.39
79 0.46
80 0.48
81 0.49
82 0.47
83 0.49
84 0.52
85 0.49
86 0.48
87 0.48
88 0.52
89 0.54
90 0.57
91 0.6
92 0.61
93 0.65
94 0.64
95 0.65
96 0.64
97 0.7
98 0.74
99 0.77
100 0.79
101 0.73
102 0.71
103 0.67
104 0.62
105 0.54
106 0.46
107 0.36
108 0.29
109 0.25
110 0.25
111 0.2
112 0.17
113 0.17
114 0.18
115 0.18