Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EHW1

Protein Details
Accession I3EHW1   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
157-180EVPHKFIKKVRMWIKQQKKSGRIAHydrophilic
NLS Segment(s)
PositionSequence
163-176IKKVRMWIKQQKKS
Subcellular Location(s) nucl 15, cyto_nucl 9.5, cysk 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR044613  Nep1/2-like  
IPR038765  Papain-like_cys_pep_sf  
IPR003653  Peptidase_C48_C  
Gene Ontology GO:0008234  F:cysteine-type peptidase activity  
GO:0019784  F:deNEDDylase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02902  Peptidase_C48  
PROSITE View protein in PROSITE  
PS50600  ULP_PROTEASE  
Amino Acid Sequences MDWLDDTDINLFLKVIVDSVEHAAMVGYPIVNPDRISTLVCSSFYFESLRKKGMECISRWVQGFDLTKISNIVFPLYSDSHWSLCYIDVKAETAIVYDSMRPMHSNLSKVLLTHSFVKIVLYSERCAQQKNGHDCGCYALYYATCIIRRKRDRLNLEVPHKFIKKVRMWIKQQKKSGRIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.07
5 0.09
6 0.11
7 0.11
8 0.09
9 0.09
10 0.09
11 0.08
12 0.08
13 0.07
14 0.05
15 0.05
16 0.07
17 0.08
18 0.1
19 0.1
20 0.11
21 0.13
22 0.14
23 0.15
24 0.15
25 0.17
26 0.18
27 0.19
28 0.18
29 0.18
30 0.18
31 0.18
32 0.18
33 0.17
34 0.24
35 0.26
36 0.28
37 0.26
38 0.27
39 0.32
40 0.37
41 0.4
42 0.33
43 0.38
44 0.39
45 0.41
46 0.41
47 0.35
48 0.28
49 0.27
50 0.28
51 0.22
52 0.2
53 0.17
54 0.17
55 0.17
56 0.17
57 0.13
58 0.11
59 0.11
60 0.08
61 0.08
62 0.11
63 0.11
64 0.11
65 0.12
66 0.13
67 0.13
68 0.13
69 0.13
70 0.11
71 0.11
72 0.13
73 0.1
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.07
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.07
88 0.07
89 0.08
90 0.13
91 0.15
92 0.17
93 0.17
94 0.2
95 0.19
96 0.19
97 0.21
98 0.16
99 0.16
100 0.17
101 0.17
102 0.14
103 0.14
104 0.14
105 0.12
106 0.13
107 0.15
108 0.14
109 0.15
110 0.17
111 0.23
112 0.23
113 0.25
114 0.26
115 0.29
116 0.37
117 0.43
118 0.47
119 0.43
120 0.42
121 0.41
122 0.42
123 0.36
124 0.26
125 0.19
126 0.13
127 0.12
128 0.13
129 0.14
130 0.14
131 0.17
132 0.23
133 0.28
134 0.37
135 0.45
136 0.51
137 0.59
138 0.65
139 0.69
140 0.71
141 0.76
142 0.75
143 0.77
144 0.74
145 0.68
146 0.66
147 0.61
148 0.56
149 0.5
150 0.51
151 0.49
152 0.54
153 0.61
154 0.63
155 0.71
156 0.79
157 0.85
158 0.85
159 0.87
160 0.87