Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177UG28

Protein Details
Accession A0A177UG28   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
103-124DYPSSERIRSQRTRRRPEAEDSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, plas 5, E.R. 3, golg 3, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MKLILILLGSIMVASGVMSEDTCYNYARGCTTGNGNDFDRAYRHCRCLDFVRAAGKFSEDMHGDTQERPRTEYASCDDVPRQWTTPDKPAGGMTEPIDSLGLDYPSSERIRSQRTRRRPEAEDSNGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.04
6 0.05
7 0.06
8 0.08
9 0.09
10 0.1
11 0.1
12 0.11
13 0.12
14 0.13
15 0.14
16 0.13
17 0.14
18 0.17
19 0.22
20 0.23
21 0.24
22 0.24
23 0.25
24 0.24
25 0.23
26 0.21
27 0.19
28 0.23
29 0.24
30 0.27
31 0.28
32 0.29
33 0.32
34 0.35
35 0.37
36 0.34
37 0.33
38 0.35
39 0.32
40 0.32
41 0.27
42 0.23
43 0.18
44 0.15
45 0.16
46 0.1
47 0.11
48 0.12
49 0.13
50 0.13
51 0.14
52 0.19
53 0.2
54 0.2
55 0.2
56 0.2
57 0.21
58 0.2
59 0.22
60 0.2
61 0.21
62 0.21
63 0.21
64 0.21
65 0.21
66 0.23
67 0.23
68 0.2
69 0.17
70 0.23
71 0.25
72 0.31
73 0.33
74 0.31
75 0.3
76 0.29
77 0.3
78 0.26
79 0.24
80 0.18
81 0.15
82 0.15
83 0.14
84 0.13
85 0.1
86 0.1
87 0.09
88 0.09
89 0.07
90 0.08
91 0.09
92 0.14
93 0.15
94 0.15
95 0.17
96 0.23
97 0.33
98 0.42
99 0.52
100 0.58
101 0.67
102 0.77
103 0.83
104 0.84
105 0.8
106 0.8
107 0.79