Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EIQ9

Protein Details
Accession I3EIQ9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-39FSPKHREELKKSQNKSKKKKEKDYDVRGSGKBasic
NLS Segment(s)
PositionSequence
13-30HREELKKSQNKSKKKKEK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MASTIDDIFSPKHREELKKSQNKSKKKKEKDYDVRGSGKLEQDIFSCDGYKIYTHEELNIGRGGNTSKCPIDCDCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.47
3 0.56
4 0.62
5 0.66
6 0.71
7 0.74
8 0.77
9 0.81
10 0.83
11 0.83
12 0.83
13 0.84
14 0.9
15 0.89
16 0.92
17 0.92
18 0.9
19 0.88
20 0.82
21 0.75
22 0.64
23 0.56
24 0.47
25 0.38
26 0.29
27 0.21
28 0.16
29 0.13
30 0.15
31 0.15
32 0.13
33 0.12
34 0.11
35 0.11
36 0.11
37 0.11
38 0.1
39 0.13
40 0.16
41 0.15
42 0.17
43 0.19
44 0.19
45 0.21
46 0.21
47 0.17
48 0.13
49 0.15
50 0.16
51 0.16
52 0.18
53 0.2
54 0.22
55 0.22
56 0.26
57 0.28