Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EHB9

Protein Details
Accession I3EHB9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-92HKIAKRASLKEKKTPKREKAHSHSVRCGEBasic
NLS Segment(s)
PositionSequence
67-82AKRASLKEKKTPKREK
Subcellular Location(s) cyto_nucl 14, nucl 13, cyto 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR003923  TFIID_30kDa  
Gene Ontology GO:0005634  C:nucleus  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF03540  TFIID_30kDa  
Amino Acid Sequences MDDSTFNKINEGLDSFIPLIPDVVLDHCFTKAGLATDDPKIKKLVSLIAQKLITDVATCAYQYHKIAKRASLKEKKTPKREKAHSHSVRCGECPERVRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.16
5 0.13
6 0.11
7 0.09
8 0.09
9 0.07
10 0.08
11 0.09
12 0.09
13 0.1
14 0.1
15 0.1
16 0.09
17 0.09
18 0.09
19 0.09
20 0.09
21 0.1
22 0.12
23 0.16
24 0.22
25 0.22
26 0.22
27 0.22
28 0.2
29 0.2
30 0.18
31 0.19
32 0.2
33 0.26
34 0.25
35 0.28
36 0.28
37 0.27
38 0.26
39 0.21
40 0.15
41 0.09
42 0.08
43 0.05
44 0.05
45 0.05
46 0.06
47 0.07
48 0.09
49 0.11
50 0.19
51 0.25
52 0.3
53 0.32
54 0.39
55 0.47
56 0.52
57 0.61
58 0.63
59 0.62
60 0.66
61 0.75
62 0.78
63 0.8
64 0.83
65 0.82
66 0.83
67 0.88
68 0.89
69 0.87
70 0.88
71 0.87
72 0.83
73 0.81
74 0.78
75 0.71
76 0.62
77 0.59
78 0.51
79 0.49