Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177U7Y2

Protein Details
Accession A0A177U7Y2   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-115VALGARNKRNKIRQSLRRREAMQKTKKAKEHydrophilic
NLS Segment(s)
PositionSequence
87-115ALGARNKRNKIRQSLRRREAMQKTKKAKE
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MRKRDVEEGKAVSGEKITLNLGKLTEEEKERIEEDPVIAEENRKYEEALATLSAATGKTLSVMVPAKTLEELGTSSRQDIARAAKVALGARNKRNKIRQSLRRREAMQKTKKAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.14
3 0.12
4 0.13
5 0.13
6 0.14
7 0.15
8 0.14
9 0.14
10 0.14
11 0.14
12 0.16
13 0.17
14 0.17
15 0.17
16 0.19
17 0.19
18 0.19
19 0.2
20 0.17
21 0.14
22 0.14
23 0.13
24 0.13
25 0.12
26 0.12
27 0.12
28 0.13
29 0.14
30 0.13
31 0.12
32 0.11
33 0.12
34 0.11
35 0.11
36 0.09
37 0.08
38 0.07
39 0.07
40 0.06
41 0.05
42 0.05
43 0.04
44 0.03
45 0.04
46 0.04
47 0.04
48 0.07
49 0.08
50 0.08
51 0.09
52 0.1
53 0.1
54 0.09
55 0.1
56 0.07
57 0.06
58 0.07
59 0.08
60 0.11
61 0.11
62 0.11
63 0.14
64 0.15
65 0.14
66 0.17
67 0.19
68 0.2
69 0.21
70 0.21
71 0.18
72 0.2
73 0.22
74 0.24
75 0.28
76 0.3
77 0.38
78 0.47
79 0.52
80 0.59
81 0.66
82 0.69
83 0.72
84 0.77
85 0.79
86 0.81
87 0.86
88 0.85
89 0.84
90 0.81
91 0.8
92 0.8
93 0.8
94 0.79
95 0.79