Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177UB54

Protein Details
Accession A0A177UB54   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
72-94SKIKNKSYRRVAREEKDKQKQKMBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11.833, cyto 10, cyto_pero 7.333
Family & Domain DBs
Amino Acid Sequences MVDGEGDEDQDEDEDDHRGPLRYGARTDAGALGAKTGSLALPLPVILEEQVEERRRELARMRELMFRAEQVSKIKNKSYRRVAREEKDKQKQKMADSGGCGGAARVIGST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.11
4 0.13
5 0.14
6 0.13
7 0.18
8 0.23
9 0.24
10 0.25
11 0.27
12 0.27
13 0.26
14 0.27
15 0.21
16 0.17
17 0.15
18 0.14
19 0.11
20 0.09
21 0.08
22 0.07
23 0.06
24 0.05
25 0.04
26 0.05
27 0.04
28 0.04
29 0.04
30 0.05
31 0.05
32 0.05
33 0.04
34 0.04
35 0.04
36 0.06
37 0.1
38 0.13
39 0.13
40 0.13
41 0.17
42 0.17
43 0.19
44 0.23
45 0.26
46 0.29
47 0.33
48 0.34
49 0.35
50 0.35
51 0.36
52 0.31
53 0.24
54 0.21
55 0.18
56 0.18
57 0.17
58 0.22
59 0.25
60 0.27
61 0.33
62 0.38
63 0.44
64 0.51
65 0.59
66 0.63
67 0.64
68 0.71
69 0.74
70 0.76
71 0.79
72 0.8
73 0.8
74 0.81
75 0.84
76 0.79
77 0.79
78 0.75
79 0.69
80 0.67
81 0.63
82 0.56
83 0.51
84 0.49
85 0.41
86 0.36
87 0.31
88 0.22
89 0.17
90 0.13