Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EFZ3

Protein Details
Accession I3EFZ3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
155-174SSNPSTSRKSGKKGGKKSKHBasic
NLS Segment(s)
PositionSequence
162-174RKSGKKGGKKSKH
Subcellular Location(s) extr 23, mito 1, cyto 1, E.R. 1, golg 1, cyto_mito 1
Family & Domain DBs
Amino Acid Sequences MILRSIMNKTLALIFGLLILTFFTLSVSASMEESESMEAGSSESVSESSEEVSESSVSEDSASAASASEESASASGSSASEESAAAASESASASGASASEQSAAAGETASATGASASGASASGASASGAAGESASGAAAINASEGAAGAAGAESSSNPSTSRKSGKKGGKKSKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.08
5 0.06
6 0.05
7 0.05
8 0.05
9 0.05
10 0.04
11 0.04
12 0.05
13 0.06
14 0.07
15 0.07
16 0.07
17 0.07
18 0.08
19 0.08
20 0.08
21 0.08
22 0.07
23 0.06
24 0.06
25 0.06
26 0.05
27 0.05
28 0.05
29 0.04
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.03
75 0.04
76 0.04
77 0.03
78 0.04
79 0.03
80 0.03
81 0.03
82 0.04
83 0.03
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.04
92 0.04
93 0.04
94 0.03
95 0.03
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.08
142 0.09
143 0.09
144 0.11
145 0.14
146 0.2
147 0.26
148 0.37
149 0.4
150 0.46
151 0.55
152 0.65
153 0.72
154 0.79