Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177U3N0

Protein Details
Accession A0A177U3N0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
189-218STDPGASSKKRKKDRERDMRRTRLQRLQQIHydrophilic
NLS Segment(s)
PositionSequence
196-209SKKRKKDRERDMRR
Subcellular Location(s) nucl 13, mito 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MTRAQWYGVSLHRSGAASVAESLHSHELAQGTGAEKLKDRPVVRLIDRLQHSRSLVSFEWRKPAEGPSARFDPLLITQTTDGTARIWATVIDQSLQFRLWSSVLATASVPTRSTPRSDVASDRKGKMPERVFYLGAQEVIMAFRAHIWELEKEHMRAELGVEDFDLPEGTASTFSTSSDGVDASKTAISTDPGASSKKRKKDRERDMRRTRLQRLQQIVSETPDMFLTNLEDGTLRITAVANIDRSPPTLFQSITISHVLRLPRSPASFTSRRASCQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.18
4 0.14
5 0.15
6 0.15
7 0.13
8 0.12
9 0.15
10 0.15
11 0.14
12 0.13
13 0.14
14 0.14
15 0.13
16 0.14
17 0.12
18 0.11
19 0.15
20 0.17
21 0.16
22 0.17
23 0.2
24 0.25
25 0.31
26 0.31
27 0.32
28 0.36
29 0.43
30 0.43
31 0.48
32 0.45
33 0.46
34 0.49
35 0.49
36 0.45
37 0.42
38 0.41
39 0.34
40 0.33
41 0.3
42 0.27
43 0.3
44 0.35
45 0.32
46 0.4
47 0.38
48 0.39
49 0.35
50 0.37
51 0.39
52 0.38
53 0.4
54 0.37
55 0.39
56 0.38
57 0.37
58 0.33
59 0.26
60 0.22
61 0.22
62 0.17
63 0.14
64 0.14
65 0.15
66 0.15
67 0.13
68 0.11
69 0.08
70 0.09
71 0.08
72 0.08
73 0.08
74 0.07
75 0.08
76 0.09
77 0.09
78 0.09
79 0.09
80 0.1
81 0.11
82 0.11
83 0.1
84 0.09
85 0.1
86 0.09
87 0.09
88 0.09
89 0.11
90 0.11
91 0.11
92 0.11
93 0.1
94 0.11
95 0.11
96 0.11
97 0.08
98 0.11
99 0.12
100 0.14
101 0.16
102 0.17
103 0.2
104 0.21
105 0.27
106 0.3
107 0.37
108 0.39
109 0.38
110 0.4
111 0.4
112 0.4
113 0.42
114 0.39
115 0.33
116 0.35
117 0.36
118 0.33
119 0.3
120 0.3
121 0.23
122 0.18
123 0.16
124 0.1
125 0.07
126 0.06
127 0.07
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.05
134 0.07
135 0.08
136 0.1
137 0.14
138 0.15
139 0.15
140 0.16
141 0.15
142 0.14
143 0.12
144 0.11
145 0.1
146 0.08
147 0.08
148 0.08
149 0.07
150 0.07
151 0.07
152 0.07
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.05
159 0.06
160 0.06
161 0.07
162 0.08
163 0.07
164 0.08
165 0.08
166 0.08
167 0.06
168 0.07
169 0.07
170 0.06
171 0.07
172 0.07
173 0.07
174 0.07
175 0.08
176 0.1
177 0.1
178 0.11
179 0.12
180 0.15
181 0.18
182 0.27
183 0.34
184 0.42
185 0.51
186 0.6
187 0.7
188 0.78
189 0.86
190 0.88
191 0.91
192 0.93
193 0.94
194 0.93
195 0.91
196 0.89
197 0.85
198 0.84
199 0.81
200 0.78
201 0.74
202 0.68
203 0.61
204 0.58
205 0.51
206 0.45
207 0.39
208 0.3
209 0.24
210 0.21
211 0.18
212 0.13
213 0.12
214 0.11
215 0.09
216 0.09
217 0.09
218 0.08
219 0.08
220 0.1
221 0.1
222 0.07
223 0.07
224 0.08
225 0.08
226 0.11
227 0.14
228 0.14
229 0.14
230 0.17
231 0.18
232 0.19
233 0.21
234 0.19
235 0.21
236 0.23
237 0.22
238 0.21
239 0.25
240 0.24
241 0.25
242 0.28
243 0.24
244 0.21
245 0.25
246 0.25
247 0.24
248 0.26
249 0.27
250 0.3
251 0.32
252 0.35
253 0.36
254 0.42
255 0.45
256 0.47
257 0.51
258 0.48