Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177U912

Protein Details
Accession A0A177U912    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKNKGKGGKNRRRGKNENENEKRELBasic
NLS Segment(s)
PositionSequence
3-17KNKGKGGKNRRRGKN
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
Amino Acid Sequences MPKNKGKGGKNRRRGKNENENEKRELVFKEEGQEYAQVIKMLGNGRLEAQCFDGEKRLAHIRGKLRKKVWIGQGDIILLSLRDFQDDKADVIQKYSSDEARSLKQYGELPESAKINETDTFGEDEGGDVEFEEASDDDLDDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.88
4 0.87
5 0.88
6 0.87
7 0.82
8 0.75
9 0.69
10 0.6
11 0.52
12 0.43
13 0.37
14 0.31
15 0.27
16 0.28
17 0.27
18 0.27
19 0.25
20 0.24
21 0.19
22 0.17
23 0.17
24 0.12
25 0.11
26 0.11
27 0.12
28 0.13
29 0.15
30 0.14
31 0.13
32 0.15
33 0.16
34 0.16
35 0.13
36 0.13
37 0.12
38 0.12
39 0.13
40 0.14
41 0.14
42 0.14
43 0.16
44 0.19
45 0.21
46 0.22
47 0.27
48 0.33
49 0.41
50 0.48
51 0.52
52 0.49
53 0.53
54 0.54
55 0.55
56 0.54
57 0.5
58 0.45
59 0.4
60 0.38
61 0.32
62 0.28
63 0.21
64 0.14
65 0.08
66 0.06
67 0.06
68 0.05
69 0.06
70 0.07
71 0.07
72 0.12
73 0.13
74 0.13
75 0.15
76 0.19
77 0.18
78 0.19
79 0.19
80 0.15
81 0.17
82 0.18
83 0.16
84 0.14
85 0.17
86 0.18
87 0.21
88 0.24
89 0.22
90 0.2
91 0.23
92 0.25
93 0.26
94 0.27
95 0.25
96 0.23
97 0.25
98 0.26
99 0.23
100 0.21
101 0.18
102 0.17
103 0.17
104 0.17
105 0.16
106 0.16
107 0.18
108 0.16
109 0.16
110 0.13
111 0.12
112 0.11
113 0.1
114 0.08
115 0.06
116 0.06
117 0.06
118 0.06
119 0.07
120 0.06
121 0.07
122 0.08