Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EIL2

Protein Details
Accession I3EIL2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
114-136DLLEKTGQSWRKKRKAETDEDGYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031533  DUF5093  
Pfam View protein in Pfam  
PF17011  DUF5093  
Amino Acid Sequences MAVECITVCFPFKLQSTEFKSQYPTPVLRQEGTVAFTLPFNALINVSSEKSYTVSYTKKQKNDGTEAGFIYQIIIDFTSINDAIDFCSNPIIHVSYNEVSDLSSLDKKLEEASDLLEKTGQSWRKKRKAETDEDGYFTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.31
3 0.38
4 0.45
5 0.46
6 0.43
7 0.46
8 0.44
9 0.47
10 0.44
11 0.39
12 0.35
13 0.41
14 0.42
15 0.38
16 0.36
17 0.33
18 0.29
19 0.27
20 0.23
21 0.17
22 0.14
23 0.13
24 0.13
25 0.1
26 0.09
27 0.08
28 0.08
29 0.07
30 0.07
31 0.09
32 0.1
33 0.11
34 0.1
35 0.1
36 0.1
37 0.11
38 0.11
39 0.1
40 0.13
41 0.15
42 0.2
43 0.31
44 0.36
45 0.39
46 0.45
47 0.47
48 0.49
49 0.51
50 0.51
51 0.44
52 0.39
53 0.35
54 0.3
55 0.26
56 0.2
57 0.14
58 0.1
59 0.06
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.06
66 0.06
67 0.06
68 0.05
69 0.05
70 0.06
71 0.07
72 0.07
73 0.06
74 0.09
75 0.09
76 0.09
77 0.1
78 0.1
79 0.1
80 0.1
81 0.15
82 0.13
83 0.13
84 0.13
85 0.12
86 0.11
87 0.11
88 0.11
89 0.09
90 0.11
91 0.11
92 0.11
93 0.11
94 0.12
95 0.14
96 0.14
97 0.12
98 0.1
99 0.13
100 0.17
101 0.17
102 0.17
103 0.17
104 0.16
105 0.17
106 0.24
107 0.28
108 0.32
109 0.42
110 0.53
111 0.62
112 0.7
113 0.77
114 0.81
115 0.83
116 0.83
117 0.82
118 0.8
119 0.74