Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EGX8

Protein Details
Accession I3EGX8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
200-221EEKYREWKVKREQNKINLKKEEBasic
NLS Segment(s)
PositionSequence
6-18KGKDVIKPKEAKK
28-38KNKGKSAKLKK
Subcellular Location(s) cyto 13, cyto_nucl 10.833, cyto_pero 8.333, nucl 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032378  ZC3H15/TMA46_C  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF16543  DFRP_C  
PF00642  zf-CCCH  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MAKKDKGKDVIKPKEAKKMVEEQMFGMKNKGKSAKLKKMASSLEASYLKGKPQKVEKKVEEPVYEAYEILQKVPVGVDPSTILCVNFKANKTCSKGSSCKFSHDLTKRTTAPPAVKEMNKDVNADGVEKPVCKYYIDALKSGKHNPKWVCPNGNNCSGKHSPPEGYILKEDAAELNVITQDEMLEEKRANLPKDQTKMTEEKYREWKVKREQNKINLKKEEDKIKEGNLRLGKILPSGKDLFVYNPKIFVDDDEALDYDYNAREEKLESDEEEELAEKLTETLNITS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.74
3 0.68
4 0.63
5 0.62
6 0.61
7 0.58
8 0.54
9 0.46
10 0.5
11 0.5
12 0.44
13 0.4
14 0.37
15 0.34
16 0.4
17 0.44
18 0.41
19 0.49
20 0.59
21 0.64
22 0.68
23 0.71
24 0.69
25 0.7
26 0.67
27 0.6
28 0.54
29 0.44
30 0.42
31 0.37
32 0.34
33 0.31
34 0.29
35 0.31
36 0.32
37 0.33
38 0.32
39 0.42
40 0.51
41 0.54
42 0.63
43 0.64
44 0.67
45 0.72
46 0.72
47 0.63
48 0.55
49 0.5
50 0.43
51 0.37
52 0.29
53 0.22
54 0.2
55 0.19
56 0.17
57 0.15
58 0.11
59 0.11
60 0.12
61 0.12
62 0.11
63 0.11
64 0.11
65 0.1
66 0.11
67 0.13
68 0.13
69 0.11
70 0.09
71 0.1
72 0.14
73 0.18
74 0.19
75 0.23
76 0.26
77 0.33
78 0.38
79 0.4
80 0.4
81 0.42
82 0.48
83 0.45
84 0.51
85 0.46
86 0.45
87 0.45
88 0.43
89 0.45
90 0.44
91 0.47
92 0.41
93 0.46
94 0.43
95 0.41
96 0.43
97 0.37
98 0.34
99 0.31
100 0.33
101 0.32
102 0.31
103 0.31
104 0.33
105 0.35
106 0.32
107 0.31
108 0.25
109 0.23
110 0.22
111 0.22
112 0.17
113 0.13
114 0.13
115 0.12
116 0.13
117 0.12
118 0.12
119 0.1
120 0.11
121 0.13
122 0.2
123 0.21
124 0.22
125 0.22
126 0.25
127 0.27
128 0.33
129 0.35
130 0.3
131 0.36
132 0.36
133 0.41
134 0.46
135 0.48
136 0.48
137 0.46
138 0.52
139 0.49
140 0.56
141 0.51
142 0.43
143 0.45
144 0.4
145 0.37
146 0.32
147 0.31
148 0.23
149 0.22
150 0.28
151 0.22
152 0.22
153 0.22
154 0.19
155 0.17
156 0.16
157 0.15
158 0.1
159 0.09
160 0.07
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.04
168 0.04
169 0.06
170 0.06
171 0.07
172 0.07
173 0.09
174 0.14
175 0.19
176 0.2
177 0.23
178 0.29
179 0.34
180 0.39
181 0.4
182 0.37
183 0.37
184 0.41
185 0.41
186 0.42
187 0.37
188 0.4
189 0.47
190 0.51
191 0.54
192 0.53
193 0.58
194 0.6
195 0.68
196 0.71
197 0.72
198 0.74
199 0.76
200 0.83
201 0.84
202 0.83
203 0.8
204 0.75
205 0.73
206 0.71
207 0.71
208 0.65
209 0.61
210 0.55
211 0.55
212 0.56
213 0.49
214 0.51
215 0.45
216 0.41
217 0.37
218 0.36
219 0.3
220 0.29
221 0.31
222 0.24
223 0.25
224 0.26
225 0.25
226 0.25
227 0.25
228 0.24
229 0.29
230 0.34
231 0.29
232 0.29
233 0.29
234 0.29
235 0.28
236 0.25
237 0.25
238 0.2
239 0.21
240 0.2
241 0.2
242 0.19
243 0.19
244 0.17
245 0.13
246 0.12
247 0.13
248 0.11
249 0.12
250 0.12
251 0.14
252 0.16
253 0.18
254 0.19
255 0.19
256 0.22
257 0.23
258 0.22
259 0.21
260 0.19
261 0.15
262 0.14
263 0.13
264 0.09
265 0.09
266 0.09
267 0.1