Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I3EGK9

Protein Details
Accession I3EGK9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-33MLETILKKPKRRKIYEKRKTLLKYHydrophilic
NLS Segment(s)
PositionSequence
16-28KKPKRRKIYEKRK
Subcellular Location(s) nucl 9, mito 6.5, cyto_mito 5, plas 4, cyto 2.5, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEDKTLERAMLETILKKPKRRKIYEKRKTLLKYCYSVKFICFKAFFCSFFICFVFTYFLVLQIREYALPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.42
4 0.5
5 0.56
6 0.65
7 0.71
8 0.77
9 0.78
10 0.86
11 0.88
12 0.89
13 0.84
14 0.82
15 0.77
16 0.72
17 0.69
18 0.62
19 0.56
20 0.51
21 0.5
22 0.45
23 0.4
24 0.36
25 0.32
26 0.29
27 0.3
28 0.26
29 0.23
30 0.26
31 0.27
32 0.27
33 0.24
34 0.26
35 0.21
36 0.22
37 0.22
38 0.17
39 0.15
40 0.15
41 0.16
42 0.13
43 0.17
44 0.15
45 0.19
46 0.19
47 0.19
48 0.18
49 0.17
50 0.19