Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EDF5

Protein Details
Accession I3EDF5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
157-180EEPGLAKKEKRENRFVRNVKRIITHydrophilic
NLS Segment(s)
PositionSequence
164-164K
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013922  Cyclin_PHO80-like  
Gene Ontology GO:0019901  F:protein kinase binding  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
CDD cd20557  CYCLIN_ScPCL1-like  
Amino Acid Sequences MADKKEEVIPNEVLQNTLNKLQIADAPSNNQILYIIKRANLSSTVVLAAVSLLFTAREKLSAYIQKIRSTPESKKHRALALERATTLFNNTYILFSVCLVISSKYLIDRSYINRTWANILMINRQMLNSYEMCLLEALDYQVILTKVKLDSLLKKAEEPGLAKKEKRENRFVRNVKRIITCLFKNVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.23
5 0.23
6 0.19
7 0.19
8 0.19
9 0.22
10 0.23
11 0.24
12 0.22
13 0.23
14 0.25
15 0.26
16 0.24
17 0.2
18 0.17
19 0.16
20 0.17
21 0.19
22 0.19
23 0.19
24 0.21
25 0.21
26 0.23
27 0.21
28 0.21
29 0.16
30 0.16
31 0.14
32 0.13
33 0.12
34 0.1
35 0.08
36 0.05
37 0.04
38 0.03
39 0.03
40 0.03
41 0.04
42 0.06
43 0.06
44 0.07
45 0.08
46 0.1
47 0.16
48 0.21
49 0.24
50 0.3
51 0.33
52 0.35
53 0.35
54 0.37
55 0.38
56 0.38
57 0.4
58 0.42
59 0.49
60 0.51
61 0.56
62 0.56
63 0.52
64 0.51
65 0.48
66 0.48
67 0.44
68 0.4
69 0.35
70 0.33
71 0.3
72 0.26
73 0.24
74 0.15
75 0.09
76 0.09
77 0.09
78 0.08
79 0.08
80 0.09
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.07
91 0.07
92 0.08
93 0.08
94 0.08
95 0.1
96 0.14
97 0.21
98 0.22
99 0.24
100 0.25
101 0.26
102 0.27
103 0.26
104 0.24
105 0.19
106 0.19
107 0.2
108 0.2
109 0.2
110 0.17
111 0.16
112 0.15
113 0.13
114 0.15
115 0.12
116 0.12
117 0.13
118 0.12
119 0.13
120 0.12
121 0.11
122 0.08
123 0.08
124 0.07
125 0.06
126 0.06
127 0.05
128 0.08
129 0.08
130 0.08
131 0.08
132 0.1
133 0.1
134 0.11
135 0.14
136 0.15
137 0.21
138 0.26
139 0.32
140 0.3
141 0.31
142 0.33
143 0.33
144 0.33
145 0.3
146 0.34
147 0.36
148 0.4
149 0.41
150 0.47
151 0.54
152 0.59
153 0.63
154 0.66
155 0.66
156 0.71
157 0.8
158 0.82
159 0.83
160 0.84
161 0.81
162 0.77
163 0.73
164 0.66
165 0.6
166 0.58
167 0.5