Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EHH5

Protein Details
Accession I3EHH5    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAQRKPSKTTNNKRSTHRTTSHydrophilic
65-87ANTLDKHRKSRDHKRRLKDLLEDBasic
NLS Segment(s)
PositionSequence
72-80RKSRDHKRR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
Amino Acid Sequences MAQRKPSKTTNNKRSTHRTTSIGCKLRNRAKDYDEIRKRVEENISEPIENPKHARCIECDRVMEANTLDKHRKSRDHKRRLKDLLEDALLEQDRKNGLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.8
4 0.74
5 0.68
6 0.63
7 0.66
8 0.67
9 0.64
10 0.59
11 0.57
12 0.61
13 0.63
14 0.66
15 0.63
16 0.58
17 0.54
18 0.59
19 0.58
20 0.6
21 0.59
22 0.55
23 0.52
24 0.49
25 0.47
26 0.42
27 0.4
28 0.3
29 0.26
30 0.29
31 0.28
32 0.25
33 0.25
34 0.26
35 0.23
36 0.22
37 0.21
38 0.16
39 0.19
40 0.2
41 0.21
42 0.2
43 0.27
44 0.33
45 0.35
46 0.34
47 0.31
48 0.32
49 0.31
50 0.28
51 0.2
52 0.2
53 0.18
54 0.22
55 0.24
56 0.25
57 0.3
58 0.35
59 0.44
60 0.48
61 0.58
62 0.65
63 0.72
64 0.8
65 0.83
66 0.88
67 0.86
68 0.82
69 0.79
70 0.74
71 0.69
72 0.61
73 0.52
74 0.42
75 0.4
76 0.35
77 0.28
78 0.21
79 0.19