Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2GWW1

Protein Details
Accession I2GWW1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MVQKALKVNKKVKNPRRVTKKQKNLRKAAPLIHydrophilic
NLS Segment(s)
PositionSequence
7-46KVNKKVKNPRRVTKKQKNLRKAAPLIIKSKKKGLQHMKKL
73-84TRKEIEKGKNKK
Subcellular Location(s) nucl 20, mito_nucl 13.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG tbl:TBLA_0A08240  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MVQKALKVNKKVKNPRRVTKKQKNLRKAAPLIIKSKKKGLQHMKKLNKSASLTESTERLLSSKIGHLELLKGTRKEIEKGKNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.87
4 0.9
5 0.91
6 0.91
7 0.92
8 0.91
9 0.92
10 0.91
11 0.89
12 0.86
13 0.83
14 0.76
15 0.72
16 0.69
17 0.63
18 0.6
19 0.6
20 0.57
21 0.5
22 0.53
23 0.51
24 0.47
25 0.53
26 0.56
27 0.58
28 0.63
29 0.72
30 0.75
31 0.75
32 0.76
33 0.68
34 0.62
35 0.53
36 0.45
37 0.39
38 0.33
39 0.3
40 0.26
41 0.25
42 0.21
43 0.2
44 0.17
45 0.14
46 0.11
47 0.1
48 0.11
49 0.14
50 0.15
51 0.15
52 0.16
53 0.16
54 0.17
55 0.2
56 0.24
57 0.26
58 0.25
59 0.26
60 0.31
61 0.33
62 0.37
63 0.42
64 0.47