Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H4D6

Protein Details
Accession I2H4D6    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-43QGTSNIEKNKRGNKKNIYRRKNNNNRTKNETSNEHydrophilic
49-78LNKPNSRTNSRSRSRNRPRNSNGNRQSRNDHydrophilic
98-122NNSNRSNNRSRNSRRKNDNYDKSNSHydrophilic
NLS Segment(s)
PositionSequence
19-29KRGNKKNIYRR
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
KEGG tbl:TBLA_0E01840  -  
Amino Acid Sequences MEDSDSRSPQGTSNIEKNKRGNKKNIYRRKNNNNRTKNETSNEDSNSSLNKPNSRTNSRSRSRNRPRNSNGNRQSRNDEKSNVDISESNHERSNSNGNNSNRSNNRSRNSRRKNDNYDKSNSRSNSNFKSYQPRDKLSAERLKILGDNQNKINKELEICSRVLGSKSFKLFKKNSDSISYGYTIHNINISDISKFKILVEIPNEYPNKPINLSLNNKSIVTMSRTMEISNEDSKFQKQVAYLQKSIRNFNFKVLELQLANEPILAQLNYFVQNLDILMNSNYKNISEISKTFYNQFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.61
4 0.67
5 0.69
6 0.74
7 0.77
8 0.77
9 0.78
10 0.83
11 0.87
12 0.9
13 0.9
14 0.9
15 0.92
16 0.93
17 0.94
18 0.93
19 0.93
20 0.92
21 0.89
22 0.87
23 0.84
24 0.8
25 0.74
26 0.7
27 0.65
28 0.62
29 0.58
30 0.51
31 0.44
32 0.38
33 0.35
34 0.32
35 0.32
36 0.3
37 0.32
38 0.35
39 0.42
40 0.5
41 0.54
42 0.57
43 0.61
44 0.67
45 0.69
46 0.75
47 0.75
48 0.77
49 0.81
50 0.85
51 0.84
52 0.84
53 0.84
54 0.85
55 0.85
56 0.85
57 0.83
58 0.84
59 0.81
60 0.74
61 0.74
62 0.7
63 0.68
64 0.62
65 0.56
66 0.49
67 0.48
68 0.47
69 0.39
70 0.33
71 0.29
72 0.26
73 0.31
74 0.3
75 0.27
76 0.27
77 0.27
78 0.26
79 0.26
80 0.34
81 0.28
82 0.3
83 0.36
84 0.35
85 0.42
86 0.43
87 0.48
88 0.43
89 0.46
90 0.49
91 0.49
92 0.53
93 0.57
94 0.64
95 0.68
96 0.74
97 0.78
98 0.8
99 0.82
100 0.87
101 0.87
102 0.87
103 0.82
104 0.79
105 0.75
106 0.68
107 0.65
108 0.56
109 0.49
110 0.44
111 0.44
112 0.42
113 0.43
114 0.42
115 0.38
116 0.47
117 0.48
118 0.53
119 0.52
120 0.49
121 0.47
122 0.47
123 0.48
124 0.46
125 0.48
126 0.4
127 0.37
128 0.35
129 0.31
130 0.29
131 0.27
132 0.25
133 0.21
134 0.22
135 0.24
136 0.28
137 0.28
138 0.29
139 0.28
140 0.21
141 0.2
142 0.19
143 0.19
144 0.17
145 0.17
146 0.16
147 0.15
148 0.15
149 0.15
150 0.15
151 0.15
152 0.16
153 0.2
154 0.25
155 0.26
156 0.33
157 0.35
158 0.39
159 0.45
160 0.45
161 0.45
162 0.44
163 0.44
164 0.37
165 0.37
166 0.31
167 0.24
168 0.2
169 0.18
170 0.15
171 0.13
172 0.13
173 0.11
174 0.11
175 0.12
176 0.12
177 0.11
178 0.11
179 0.13
180 0.11
181 0.12
182 0.11
183 0.13
184 0.13
185 0.16
186 0.18
187 0.21
188 0.21
189 0.28
190 0.29
191 0.26
192 0.28
193 0.26
194 0.25
195 0.22
196 0.23
197 0.21
198 0.28
199 0.34
200 0.36
201 0.38
202 0.37
203 0.36
204 0.34
205 0.3
206 0.25
207 0.23
208 0.22
209 0.19
210 0.2
211 0.21
212 0.2
213 0.2
214 0.21
215 0.2
216 0.21
217 0.21
218 0.2
219 0.22
220 0.24
221 0.24
222 0.22
223 0.21
224 0.17
225 0.25
226 0.33
227 0.38
228 0.41
229 0.45
230 0.5
231 0.51
232 0.57
233 0.55
234 0.52
235 0.46
236 0.49
237 0.48
238 0.43
239 0.45
240 0.39
241 0.37
242 0.3
243 0.3
244 0.26
245 0.23
246 0.22
247 0.17
248 0.15
249 0.11
250 0.14
251 0.12
252 0.09
253 0.09
254 0.12
255 0.14
256 0.14
257 0.13
258 0.11
259 0.11
260 0.12
261 0.11
262 0.09
263 0.09
264 0.1
265 0.14
266 0.14
267 0.16
268 0.17
269 0.16
270 0.17
271 0.17
272 0.2
273 0.22
274 0.23
275 0.28
276 0.32
277 0.34