Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H396

Protein Details
Accession I2H396    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
78-101SKYSINIYKRHKRQKRVRFNQLILHydrophilic
131-155TNMNRIKQVPSKSKKFKANNGLLFSHydrophilic
NLS Segment(s)
PositionSequence
89-90KR
Subcellular Location(s) nucl 9.5, cyto_nucl 6, mito 4, plas 4, pero 4, extr 2, E.R. 2
Family & Domain DBs
KEGG tbl:TBLA_0D03480  -  
Amino Acid Sequences MTNYNLLNKLKNLIPFDMSILTANISDKDNDSLFFTLSLIEVLSIILVTSYPVELFELLFSTVQIVSNSYKFFKDVKSKYSINIYKRHKRQKRVRFNQLILAANKASAKKYKYDTYMKSPLSTVPSFQFTTNMNRIKQVPSKSKKFKANNGLLFSSIIFNRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.3
4 0.27
5 0.24
6 0.19
7 0.15
8 0.14
9 0.12
10 0.12
11 0.11
12 0.11
13 0.12
14 0.12
15 0.15
16 0.15
17 0.15
18 0.17
19 0.16
20 0.15
21 0.14
22 0.13
23 0.1
24 0.09
25 0.09
26 0.06
27 0.05
28 0.05
29 0.04
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.05
48 0.06
49 0.06
50 0.07
51 0.07
52 0.08
53 0.08
54 0.1
55 0.12
56 0.12
57 0.12
58 0.13
59 0.14
60 0.17
61 0.25
62 0.26
63 0.29
64 0.34
65 0.34
66 0.34
67 0.42
68 0.43
69 0.37
70 0.44
71 0.48
72 0.52
73 0.6
74 0.7
75 0.68
76 0.74
77 0.8
78 0.82
79 0.85
80 0.86
81 0.88
82 0.85
83 0.79
84 0.75
85 0.69
86 0.63
87 0.52
88 0.44
89 0.33
90 0.25
91 0.25
92 0.2
93 0.17
94 0.18
95 0.19
96 0.21
97 0.26
98 0.31
99 0.36
100 0.43
101 0.46
102 0.49
103 0.56
104 0.53
105 0.49
106 0.44
107 0.4
108 0.38
109 0.34
110 0.28
111 0.22
112 0.25
113 0.25
114 0.24
115 0.24
116 0.2
117 0.27
118 0.33
119 0.36
120 0.33
121 0.35
122 0.37
123 0.42
124 0.46
125 0.48
126 0.5
127 0.54
128 0.64
129 0.71
130 0.77
131 0.8
132 0.82
133 0.83
134 0.83
135 0.84
136 0.82
137 0.77
138 0.71
139 0.61
140 0.54
141 0.44
142 0.37