Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H7I1

Protein Details
Accession I2H7I1    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-35GLLWKRSWRMSRPQKQRLRGRLTQIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12.333, cyto_nucl 3.833, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
KEGG tbl:TBLA_0H00400  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKVSQPLLGGLLWKRSWRMSRPQKQRLRGRLTQIDKVIETVTTGLKQELLKTQSLGEPLILPQIVKDLNNSKIFPKESQMLPRDKYTVFDKKVRGYRKSVHHVPKWTKISQRTNPENY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.28
4 0.35
5 0.37
6 0.46
7 0.52
8 0.61
9 0.7
10 0.78
11 0.81
12 0.84
13 0.89
14 0.87
15 0.85
16 0.8
17 0.78
18 0.77
19 0.73
20 0.69
21 0.61
22 0.53
23 0.45
24 0.4
25 0.31
26 0.22
27 0.17
28 0.12
29 0.1
30 0.09
31 0.09
32 0.08
33 0.1
34 0.1
35 0.11
36 0.15
37 0.16
38 0.16
39 0.16
40 0.17
41 0.16
42 0.16
43 0.15
44 0.1
45 0.08
46 0.08
47 0.08
48 0.07
49 0.06
50 0.05
51 0.07
52 0.07
53 0.07
54 0.09
55 0.12
56 0.17
57 0.2
58 0.21
59 0.21
60 0.25
61 0.28
62 0.26
63 0.26
64 0.25
65 0.26
66 0.33
67 0.37
68 0.37
69 0.38
70 0.39
71 0.38
72 0.34
73 0.34
74 0.33
75 0.37
76 0.36
77 0.4
78 0.42
79 0.48
80 0.56
81 0.6
82 0.58
83 0.55
84 0.59
85 0.62
86 0.68
87 0.69
88 0.71
89 0.71
90 0.76
91 0.77
92 0.79
93 0.75
94 0.72
95 0.7
96 0.7
97 0.73
98 0.72
99 0.76