Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EA17

Protein Details
Accession A0A178EA17    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
87-110DDFFNPPKERRKPKAEDKDKTSGABasic
NLS Segment(s)
PositionSequence
94-100KERRKPK
Subcellular Location(s) nucl 13, mito 7, cyto 6
Family & Domain DBs
Amino Acid Sequences MPKKTGTVHHCPGRNGWVADIPPGSCRVMASKGQKNSYCHTHQRMCPQGCDRVCLKSQPGCGLCVGRWAAEARAEKAEASSKDGKEDDFFNPPKERRKPKAEDKDKTSGAEDNDKKSEAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.45
3 0.37
4 0.35
5 0.3
6 0.31
7 0.29
8 0.23
9 0.18
10 0.2
11 0.18
12 0.14
13 0.14
14 0.14
15 0.17
16 0.23
17 0.3
18 0.35
19 0.4
20 0.47
21 0.51
22 0.51
23 0.52
24 0.52
25 0.51
26 0.5
27 0.52
28 0.53
29 0.52
30 0.58
31 0.63
32 0.57
33 0.55
34 0.51
35 0.51
36 0.45
37 0.44
38 0.36
39 0.3
40 0.29
41 0.27
42 0.26
43 0.22
44 0.23
45 0.25
46 0.24
47 0.21
48 0.21
49 0.2
50 0.17
51 0.17
52 0.16
53 0.11
54 0.11
55 0.11
56 0.11
57 0.15
58 0.17
59 0.15
60 0.16
61 0.16
62 0.15
63 0.15
64 0.2
65 0.16
66 0.2
67 0.25
68 0.23
69 0.26
70 0.27
71 0.26
72 0.23
73 0.25
74 0.22
75 0.24
76 0.26
77 0.27
78 0.34
79 0.38
80 0.46
81 0.53
82 0.61
83 0.61
84 0.69
85 0.74
86 0.78
87 0.85
88 0.86
89 0.85
90 0.83
91 0.83
92 0.76
93 0.69
94 0.6
95 0.53
96 0.46
97 0.48
98 0.44
99 0.41
100 0.42
101 0.41