Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DUF3

Protein Details
Accession A0A178DUF3    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
61-80AGIQKKQKKNNMTRAQRLRQHydrophilic
NLS Segment(s)
PositionSequence
97-128KRGKSFGKEKIVKDRAKGWEDVNGDGRKKKKA
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAKTAKVKKRQVTVHSRAARRAASPSIDLDKSAKPSNTARDSASPSRPSKINPHALAAKDAGIQKKQKKNNMTRAQRLRQQKTLERAEENMDKLQVKRGKSFGKEKIVKDRAKGWEDVNGDGRKKKKAANGFEAIEDEAKKEDREWVSDEDMDGNDLSAPAVEVNGESKEAGLVAPASVPLPVVEDELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.78
3 0.74
4 0.7
5 0.66
6 0.58
7 0.5
8 0.47
9 0.4
10 0.35
11 0.33
12 0.32
13 0.33
14 0.31
15 0.3
16 0.28
17 0.27
18 0.28
19 0.32
20 0.28
21 0.27
22 0.31
23 0.39
24 0.41
25 0.4
26 0.38
27 0.38
28 0.44
29 0.47
30 0.49
31 0.47
32 0.44
33 0.46
34 0.45
35 0.43
36 0.45
37 0.47
38 0.5
39 0.44
40 0.46
41 0.47
42 0.46
43 0.45
44 0.36
45 0.28
46 0.22
47 0.24
48 0.22
49 0.22
50 0.28
51 0.35
52 0.43
53 0.49
54 0.54
55 0.61
56 0.68
57 0.74
58 0.77
59 0.77
60 0.78
61 0.81
62 0.79
63 0.76
64 0.76
65 0.71
66 0.66
67 0.64
68 0.6
69 0.58
70 0.59
71 0.54
72 0.46
73 0.41
74 0.39
75 0.36
76 0.31
77 0.24
78 0.2
79 0.18
80 0.17
81 0.23
82 0.22
83 0.21
84 0.22
85 0.27
86 0.3
87 0.34
88 0.41
89 0.41
90 0.47
91 0.52
92 0.52
93 0.57
94 0.61
95 0.58
96 0.52
97 0.52
98 0.49
99 0.45
100 0.45
101 0.35
102 0.33
103 0.33
104 0.33
105 0.32
106 0.29
107 0.28
108 0.31
109 0.33
110 0.31
111 0.32
112 0.35
113 0.35
114 0.42
115 0.47
116 0.5
117 0.53
118 0.5
119 0.48
120 0.45
121 0.38
122 0.3
123 0.23
124 0.16
125 0.12
126 0.12
127 0.12
128 0.11
129 0.18
130 0.18
131 0.21
132 0.24
133 0.26
134 0.28
135 0.28
136 0.28
137 0.22
138 0.21
139 0.19
140 0.15
141 0.11
142 0.08
143 0.08
144 0.07
145 0.05
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.06
152 0.07
153 0.08
154 0.08
155 0.08
156 0.08
157 0.08
158 0.07
159 0.07
160 0.06
161 0.06
162 0.06
163 0.06
164 0.07
165 0.06
166 0.07
167 0.06
168 0.08
169 0.09