Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ENC2

Protein Details
Accession A0A178ENC2   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-60DVVPRIQESKHRKPTHRKPKRLNAQTPNPKHPKBasic
64-92PSAQKPKHLAPKRQKKPPNPNAERNRPKIHydrophilic
99-122KEWVSKCAKCRKTPIQKQKTSAEIHydrophilic
NLS Segment(s)
PositionSequence
37-97KHRKPTHRKPKRLNAQTPNPKHPKAQTPSAQKPKHLAPKRQKKPPNPNAERNRPKIPPKEN
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 8, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MHTPTQPSTNRPTLPRSHPPIMIRNLVDVVPRIQESKHRKPTHRKPKRLNAQTPNPKHPKAQTPSAQKPKHLAPKRQKKPPNPNAERNRPKIPPKENAKEWVSKCAKCRKTPIQKQKTSAEIPDPKQTPPIPNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.62
3 0.62
4 0.59
5 0.6
6 0.61
7 0.62
8 0.59
9 0.56
10 0.47
11 0.41
12 0.37
13 0.32
14 0.29
15 0.22
16 0.18
17 0.15
18 0.15
19 0.14
20 0.13
21 0.22
22 0.3
23 0.39
24 0.49
25 0.54
26 0.62
27 0.72
28 0.83
29 0.86
30 0.87
31 0.87
32 0.86
33 0.9
34 0.92
35 0.91
36 0.9
37 0.87
38 0.87
39 0.87
40 0.83
41 0.81
42 0.76
43 0.68
44 0.61
45 0.56
46 0.55
47 0.49
48 0.51
49 0.49
50 0.52
51 0.6
52 0.67
53 0.64
54 0.56
55 0.54
56 0.53
57 0.56
58 0.54
59 0.54
60 0.55
61 0.65
62 0.72
63 0.79
64 0.81
65 0.81
66 0.85
67 0.85
68 0.85
69 0.82
70 0.84
71 0.83
72 0.86
73 0.84
74 0.79
75 0.76
76 0.7
77 0.71
78 0.7
79 0.67
80 0.65
81 0.66
82 0.69
83 0.66
84 0.67
85 0.63
86 0.62
87 0.57
88 0.58
89 0.54
90 0.49
91 0.53
92 0.56
93 0.59
94 0.57
95 0.66
96 0.66
97 0.71
98 0.79
99 0.83
100 0.84
101 0.84
102 0.84
103 0.81
104 0.78
105 0.7
106 0.63
107 0.62
108 0.59
109 0.56
110 0.59
111 0.55
112 0.48
113 0.51
114 0.5