Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H924

Protein Details
Accession I2H924    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-106TSGWRASQYKKNKMARKTKKKGSFTRFHydrophilic
NLS Segment(s)
PositionSequence
89-101KKNKMARKTKKKG
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG tbl:TBLA_0I02180  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRAKAPLKSKSVIRHEVFQKVVDCRASRISDKLKQDLIDQKLKELKSKNPDGMEVEINVDDLKKEETKVDYSKIKTSGWRASQYKKNKMARKTKKKGSFTRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.62
3 0.64
4 0.56
5 0.58
6 0.57
7 0.59
8 0.54
9 0.48
10 0.43
11 0.36
12 0.37
13 0.33
14 0.29
15 0.26
16 0.29
17 0.29
18 0.28
19 0.32
20 0.35
21 0.38
22 0.41
23 0.42
24 0.4
25 0.37
26 0.4
27 0.41
28 0.39
29 0.39
30 0.35
31 0.34
32 0.37
33 0.37
34 0.37
35 0.33
36 0.34
37 0.35
38 0.39
39 0.39
40 0.35
41 0.36
42 0.33
43 0.32
44 0.26
45 0.19
46 0.16
47 0.12
48 0.11
49 0.1
50 0.08
51 0.06
52 0.06
53 0.08
54 0.08
55 0.08
56 0.1
57 0.13
58 0.18
59 0.21
60 0.25
61 0.29
62 0.31
63 0.35
64 0.36
65 0.35
66 0.35
67 0.39
68 0.42
69 0.41
70 0.47
71 0.48
72 0.53
73 0.61
74 0.66
75 0.7
76 0.71
77 0.75
78 0.75
79 0.8
80 0.83
81 0.85
82 0.87
83 0.87
84 0.88
85 0.89
86 0.91